KEGG   Felis catus (domestic cat): 101095161
Entry
101095161         CDS       T02385                                 
Symbol
PPARG
Name
(RefSeq) peroxisome proliferator-activated receptor gamma isoform X1
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca03320  PPAR signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04380  Osteoclast differentiation
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease
fca05016  Huntington disease
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05216  Thyroid cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    101095161 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    101095161 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101095161 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    101095161 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    101095161 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095161 (PPARG)
   05202 Transcriptional misregulation in cancer
    101095161 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    101095161 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101095161 (PPARG)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101095161 (PPARG)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101095161 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101095161 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:fca03310]
    101095161 (PPARG)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    101095161 (PPARG)
Nuclear receptors [BR:fca03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   101095161 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Other DBs
NCBI-GeneID: 101095161
NCBI-ProteinID: XP_003982545
Ensembl: ENSFCAG00000006231
UniProt: A0A337SSZ2
LinkDB
Position
A2:53291734..53427656
AA seq 505 aa
MGETLGDSLIDPESDSFADTLSASTSQEITMVDTEMPFWPTNFGISSVDLSVMDDHSHSF
DIKPFTTVDFSSISTPHYEDLPFARADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYSKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgggtgaaactctgggagattctcttattgacccagaaagcgattcctttgctgataca
ctgtctgcaagcacttcacaagaaattaccatggttgacacagagatgccattttggccc
accaactttggaatcagctccgtggatctctccgtaatggatgaccactctcattctttt
gacatcaagcccttcaccactgtggatttctccagcatttccactccacactatgaagac
cttccattcgcaagagcagacccaatggttgctgattataagtatgacctgaagctccaa
gagtaccaaagtgcaatcaaagtggagcctgcatccccaccttattattctgaaaagact
cagctgtacagtaagcctcatgaagagccttccaactccctcatggcaattgaatgccgt
gtctgtggagataaagcttctgggtttcactatggagttcatgcgtgtgaaggatgcaag
gggttcttccggaggacaatcagattgaagctcatttacgataggtgtgaccttaactgt
cgtatccacaaaaaaagtagaaataaatgtcagtactgtcggtttcagaaatgccttgct
gtggggatgtctcataatgccatcaggtttgggcggatgccacaggcggagaaagagaag
ctgttggcagagatctccagtgatatcgaccagctgaatccagagtcggcagatctccgg
gccctggcaaaacatttgtatgactcatacataaagtccttcccgctgaccaaagcaaag
gcgagggcgatcttgacaggaaagacaacagacaaatcaccatttgttatctatgacatg
aattccttaatgatgggagaagataaaatcaagttcaaacacatcacccccttgcaagag
cagagcaaagaagtggccattcgcatctttcaggggtgtcagttccgctcagtggaagct
gtgcaggagatcacagagtatgccaaaagtatccctggttttgtaaaccttgacttgaat
gaccaagtaactctcctaaaatatggtgtccatgagatcatttacacgatgctggcctcc
ttgatgaataaagatggggttctcatatcagagggccaaggattcatgacaagggagttt
ctaaagagcctgagaaaaccctttggtgactttatggagcccaagtttgagtttgctgtg
aagttcaatgcactggaattagatgacagcgacttggcaatatttatagccgtcattatt
ctcagtggagaccgcccaggtttgctgaatgtgaagcccattgaggacatacaagacaac
ctgctgcaagccttggagctccagctcaagctaaaccacccggagtcctcccagctcttt
gccaagctgctgcagaaaatgacagacctcagacagattgtaacagaacatgtgcagcta
ttgcaagtaataaagaaaacagagacagacatgagtctccacccgctcctacaagaaatt
tacaaggacttgtattag

DBGET integrated database retrieval system