Felis catus (domestic cat): 101095411 Help Entry 101095411         CDS       T02385                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism fca  Felis catus (domestic cat) Pathway fca04015   Rap1 signaling pathway fca04810   Regulation of actin cytoskeleton fca05014   Amyotrophic lateral sclerosis fca05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101095411 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101095411 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101095411 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101095411 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101095411 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:fca04812]     101095411 (PFN4)    04147 Exosome [BR:fca04147]     101095411 (PFN4) Membrane trafficking [BR:fca04131]  Others   Actin-binding proteins    Others     101095411 (PFN4) Cytoskeleton proteins [BR:fca04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101095411 (PFN4) Exosome [BR:fca04147]  Exosomal proteins   Proteins found in most exosomes    101095411 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101095411 NCBI-ProteinID:  XP_019683406 Ensembl:  ENSFCAG00000004306 UniProt:  M3W1Z0 LinkDB All DBs Position A3:121264224..121271015 Genome browser AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcgaagcttgagtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaactcttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaaactg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system