KEGG   Felis catus (domestic cat): 101095430
Entry
101095430         CDS       T02385                                 
Symbol
CIR1
Name
(RefSeq) corepressor interacting with RBPJ 1
  KO
K06066  CBF1 interacting corepressor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04330  Notch signaling pathway
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101095430 (CIR1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101095430 (CIR1)
SSDB
Motif
Pfam: Cir_N
Other DBs
NCBI-GeneID: 101095430
NCBI-ProteinID: XP_003990927
Ensembl: ENSFCAG00000022845
UniProt: M3WZB1
LinkDB
Position
C1:complement(165240785..165290031)
AA seq 471 aa
MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMG
DERVKNGLNFMYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFG
IQVRNVRCIKCHKWGHVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFA
LKRNVLGRNLTANDPSQEYVASEGEEDPEVEFLKSLTTKQKQKLLRKLDRLEKKKKKKKK
DRKKKKLQKSRSKHRKHKNKSSSSSSSSSSSSSSSSETSESSSESDSKERKIQKKKRKKN
KCSGNSNSDSEEKDKSKKRKLYEELSSSHHNKDKAKEKPRFLKQESSRENSKWSHADSDR
KSRSHNQSPDKRRSARNERSSRSQSRDERGRRSRSRSHGSYQQREIRKRPQRSPSEEQDG
RNGPRSHGTDAYRGGKPHRENPGDKRAGVTQRERSRSRENKERLYVTITWE
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggggaagtcttttgccaatttcatgtgcaagaaggactttcatcccgcctccaaatcc
aatatcaagaaagtatggatggcagaacagaaaatatcatatgataagaagaaacaagaa
gaattaatgcaacaatatcttaaagaacaagaatcatatgataataggttgcttatggga
gatgagcgtgtaaagaatggccttaatttcatgtatgaggccccaccaggagctaaaaaa
gaaaacaaagagaaagaagaaacagaaggagagactgaatacaaatttgaatggcagaaa
ggagctccaagggaaaaatatgccaaagatgacatgaacatcagagatcagccctttggt
attcaggttcgaaatgtgaggtgcattaaatgtcacaaatggggtcatgtcaacacagat
cgagaatgtcctttgtttggtctttctggaataaatgcaagttcagttcccactgatggc
tcagggccatcgatgcacccctcggagctaatagcggagatgagaaacagtgggtttgca
ctgaaacgaaatgtactggggagaaacttgaccgcaaatgatccatcacaggaatatgtt
gcaagtgagggtgaagaagatccggaagtcgaatttttaaaatcactaacaaccaaacaa
aaacagaaacttctcaggaaattggatcgacttgagaagaaaaaaaagaaaaagaaaaaa
gacagaaaaaagaaaaagcttcagaaaagcagaagtaaacacagaaaacataaaaataaa
tcctcctcctcctcctcctcctcctcctcctcctcctcctcctccagtgagacttcagaa
agcagcagtgagagtgacagcaaagaaagaaaaatacaaaagaagaaaagaaagaaaaat
aagtgttcggggaatagcaacagtgattctgaagagaaggacaagtctaagaagagaaaa
ctttatgaagaactttctagcagtcaccataacaaggacaaagccaaggaaaagcctcgg
tttttaaaacaagagagttctagagagaatagcaaatggagccatgctgattccgacaga
aagtccaggagccataaccagagcccagacaagagaagatctgcaagaaacgagaggagc
agcaggagtcagagcagggacgagaggggtaggagaagccggagcagaagtcacggtagt
taccagcaaagagaaataagaaaacggccacagcgaagtcccagcgaagagcaggatgga
agaaatggccccagaagccacggcacagatgcctacagaggaggaaaaccgcacagggag
aacccaggagataagcgtgccggagtgacgcaaagagaacgaagcagaagtagagagaat
aaagagagactgtatgtgacaattacctgggaataa

DBGET integrated database retrieval system