KEGG   Felis catus (domestic cat): 101095507
Entry
101095507         CDS       T02385                                 
Symbol
NCF4
Name
(RefSeq) LOW QUALITY PROTEIN: neutrophil cytosol factor 4
  KO
K08012  neutrophil cytosolic factor 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04380  Osteoclast differentiation
fca04613  Neutrophil extracellular trap formation
fca04670  Leukocyte transendothelial migration
fca05020  Prion disease
fca05140  Leishmaniasis
fca05415  Diabetic cardiomyopathy
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101095507 (NCF4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101095507 (NCF4)
   04670 Leukocyte transendothelial migration
    101095507 (NCF4)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101095507 (NCF4)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101095507 (NCF4)
  09164 Neurodegenerative disease
   05020 Prion disease
    101095507 (NCF4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101095507 (NCF4)
   05415 Diabetic cardiomyopathy
    101095507 (NCF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095507 (NCF4)
Membrane trafficking [BR:fca04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    101095507 (NCF4)
SSDB
Motif
Pfam: PB1 PX SH3_2 SH3_1 SH3_9
Other DBs
NCBI-GeneID: 101095507
NCBI-ProteinID: XP_003989283
Ensembl: ENSFCAG00000019315
UniProt: M3WPA6
LinkDB
Position
B4:133146965..133168004
AA seq 339 aa
MAVAQQLRAESDFEQLPDDVAVSANIADIEEKRGFTSYFVFVIEVKTKGGSKYLIYRRYR
QFYALQSKLEERFGPENKTSPFTCSLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLP
IWVLMDEDVRIFFYQSSYDAEQVPQALRRLRPRTRKVKSESPPGALFDRMAAPRAEALFD
FTGNSKLELNFKAGDVIILLSRINKDWLEGTVRGATGIFPQSFVKILKDFPEEDDPTNWL
RCYYYEDTISTTKDIAVEEDLSSTPLFKDLLRLMRQEFQREDIALNYRDAEGDLVRLLSD
EDVALMVRQAQGLPSQKRLFSWKLHVTQKDDYKVYNTVP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggccgtggcccagcagctgcgggctgagagcgactttgaacagcttcccgatgacgta
gccgtctcggccaacatcgctgacatcgaggagaagaggggcttcaccagctactttgtt
tttgtcatcgaggtgaagactaaaggaggatccaagtatctcatctaccgccgttaccgc
cagttctacgccttgcagagcaagctggaggagcgcttcgggcccgagaacaagaccagc
ccgttcacctgcagcctgcccacacttccggccaaagtgtacgtgggtgtgaaacaggag
atcgctgagatgcggattcctgccctcaacgcctacatgaagagcctcctcagccttccc
atctgggtgctgatggacgaggacgtccggatcttcttctaccagtcatcctatgacgcg
gagcaggtaccccaggcgctgcgccggctccggccacgcacccggaaagtcaagagtgag
tccccgccaggcgccctctttgaccgcatggccgctccgagagcagaggccctgtttgac
ttcactgggaacagcaaactggagctgaatttcaaagctggagatgtgatcatccttctc
agtcggatcaataaagactggctggagggcaccgtccggggagccacgggcatcttccca
cagtcgttcgtgaagatcctcaaggacttcccggaggaagacgaccccaccaactggctc
cgctgttactactatgaggacaccatcagcaccaccaaggacatcgcggtggaggaagac
ctcagcagcactccgctattcaaggacttgctgcggctcatgaggcaggagttccagagg
gaggacatcgccctcaattaccgggatgccgagggggacctggttcggctgctttcagat
gaggatgtggcgctcatggtgagacaggcccaaggtctcccctcccagaagcgcctcttc
tcctggaagctacatgtcacccagaaggatgactacaaagtctacaacactgtcccctga

DBGET integrated database retrieval system