KEGG   Felis catus (domestic cat): 101095593
Entry
101095593         CDS       T02385                                 
Symbol
VAMP3
Name
(RefSeq) vesicle-associated membrane protein 3
  KO
K13505  vesicle-associated membrane protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04130  SNARE interactions in vesicular transport
fca04145  Phagosome
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    101095593 (VAMP3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101095593 (VAMP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095593 (VAMP3)
Membrane trafficking [BR:fca04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    101095593 (VAMP3)
SSDB
Motif
Pfam: Synaptobrevin MFS_Mycoplasma ERM_helical CD34_antigen MCU DUF3619 RIFIN BTP DUF6480 Prominin
Other DBs
NCBI-GeneID: 101095593
NCBI-ProteinID: XP_023113822
LinkDB
Position
C1:5350248..5359896
AA seq 103 aa
MSTGAPAGSSAASGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAG
ASQFETSAAKLKRKYWWKNCKMWAIGIVVVVVIIIIIVWNVSP
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctacaggtgcacctgcaggttcgagtgctgcctctggcagtaaccgaagacttcag
cagacacaaaatcaagtggatgaggtggtggacatcatgagagtcaacgtggataaggtg
ttggaaagagatcagaagctctcggaattagatgatcgtgcagacgcactgcaggctgga
gcttcccaatttgaaacaagtgccgccaagctgaagagaaaatactggtggaagaattgc
aagatgtgggcgatagggattgtcgtcgtggtcgtcatcatcatcatcatcgtgtggaac
gtgtccccgtga

DBGET integrated database retrieval system