KEGG   Felis catus (domestic cat): 101095617
Entry
101095617         CDS       T02385                                 
Symbol
CHUK
Name
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X1
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01523  Antifolate resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04068  FoxO signaling pathway
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04380  Osteoclast differentiation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04920  Adipocytokine signaling pathway
fca04936  Alcoholic liver disease
fca05010  Alzheimer disease
fca05132  Salmonella infection
fca05135  Yersinia infection
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05200  Pathways in cancer
fca05208  Chemical carcinogenesis - reactive oxygen species
fca05212  Pancreatic cancer
fca05215  Prostate cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101095617 (CHUK)
   04014 Ras signaling pathway
    101095617 (CHUK)
   04064 NF-kappa B signaling pathway
    101095617 (CHUK)
   04668 TNF signaling pathway
    101095617 (CHUK)
   04068 FoxO signaling pathway
    101095617 (CHUK)
   04151 PI3K-Akt signaling pathway
    101095617 (CHUK)
   04150 mTOR signaling pathway
    101095617 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101095617 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101095617 (CHUK)
   04621 NOD-like receptor signaling pathway
    101095617 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    101095617 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    101095617 (CHUK)
   04625 C-type lectin receptor signaling pathway
    101095617 (CHUK)
   04660 T cell receptor signaling pathway
    101095617 (CHUK)
   04658 Th1 and Th2 cell differentiation
    101095617 (CHUK)
   04659 Th17 cell differentiation
    101095617 (CHUK)
   04657 IL-17 signaling pathway
    101095617 (CHUK)
   04662 B cell receptor signaling pathway
    101095617 (CHUK)
   04062 Chemokine signaling pathway
    101095617 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101095617 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101095617 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095617 (CHUK)
   05208 Chemical carcinogenesis - reactive oxygen species
    101095617 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101095617 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101095617 (CHUK)
   05221 Acute myeloid leukemia
    101095617 (CHUK)
   05220 Chronic myeloid leukemia
    101095617 (CHUK)
   05215 Prostate cancer
    101095617 (CHUK)
   05222 Small cell lung cancer
    101095617 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101095617 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    101095617 (CHUK)
   05161 Hepatitis B
    101095617 (CHUK)
   05160 Hepatitis C
    101095617 (CHUK)
   05171 Coronavirus disease - COVID-19
    101095617 (CHUK)
   05164 Influenza A
    101095617 (CHUK)
   05162 Measles
    101095617 (CHUK)
   05168 Herpes simplex virus 1 infection
    101095617 (CHUK)
   05163 Human cytomegalovirus infection
    101095617 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101095617 (CHUK)
   05169 Epstein-Barr virus infection
    101095617 (CHUK)
   05165 Human papillomavirus infection
    101095617 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101095617 (CHUK)
   05135 Yersinia infection
    101095617 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101095617 (CHUK)
   05142 Chagas disease
    101095617 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095617 (CHUK)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101095617 (CHUK)
   05418 Fluid shear stress and atherosclerosis
    101095617 (CHUK)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101095617 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101095617 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095617 (CHUK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     101095617 (CHUK)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101095617 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 101095617
NCBI-ProteinID: XP_023096597
Ensembl: ENSFCAG00000004930
LinkDB
Position
D2:complement(60936787..60978728)
AA seq 756 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDVKIAIKSCRVELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FLLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGISTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVRDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEMALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAITPQASAWLPPTSAEREHPLSCVVTPQDGETVAQMIEENLNCLGHL
STIIHEANEEQGSSMMVQTENLQKVTPINLPLIVNI
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggagcggcccccagggctgcggccgggtgcgggcgggccctgggagatgcgcgagcgg
ctgggcaccggcggcttcgggaatgtctgcctgtaccagcatcgggaacttgatgtcaaa
atagcaattaagtcatgtcgtgtagaactaagtaccaaaaacagagaacggtggtgccat
gaaatccagatcatgaagaagttgaaccatgccaacgttgtaaaggcctgtgatgtacct
gaggagttgaattttttaattaatgatgttcctcttctagcaatggaatactgttctggc
ggagatctccggaagctactcaacaaaccagaaaattgctgtgggcttaaagaaagccag
atactttctttactgagtgatatagggtctgggatccgatatttgcatgaaaacaaaatc
atacatcgtgatctaaaacctgaaaacatagttcttcaggatgttggtggaaagattatg
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacgtct
tttgtgggaacactgcaatatctggccccagagctctttgagaacaagccttatacagct
actgttgattattggagctttgggaccatggtgtttgaatgtattgctggatataggccc
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgacaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagagcccatggaaaactggcttcagttgatgctg
aattgggatcctcagcaaagaggaggacctgttgatctcactttgaagcagccaagatgt
tttctattaatggatcacattctgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcactcgctgcagtctcgt
attgagcgcgaaactggaataagtactggttctcaagagcttctttcggagacgggaatt
tctctggatcctcggaaaccagcctctcaatgcgttctagatggagttagaggctgtgat
agctatatggtatatttgtttgataaaagtaagactgtatatgaaggaccatttgcttcc
agaagtttatctgactgtgtaaattacattgtacgggacagcaaaatacaacttccaatt
atacagttacgtaaagtatgggctgaagcagtgcattatgtgtctgggctaaaagaagac
tacagcaggctctttcaaggacaaagagcagcaatgttaagtcttcttagatataatgca
aacctgacaaaaatgaagaacactttgatctcagcatctcagcaactgaaagccaaattg
gagtttttccacaaaagcattcaacttgacttggaaagatacagtgagcagatgacttac
gggatatcctcagaaaaaatgttaaaagcatggaaggaaatggaagaaaaggctatccac
tatgctgaggtgggtgtcattggttacctggaggatcagatcatgtccctgcatactgaa
atcatggagctacagaagagcccttatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctgtataagcagttaaagcacagaccttcagatcactcctac
agcgacagcacagaaatggtgaagatcattgtacatactgttcagagtcaggaccgggtt
ctcaaggagctgtttggtcatctgagcaagttattgggctgtaagcagaagattattgat
ctactgcccaaggtggaaatggccctcagtaacatcaaagaagctgacaatactgtcatg
tttatgcagggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcaataacccctcaggcatca
gcatggcttcccccaacttcagcagaacgtgaacatcccctgtcatgcgtggtaactcct
caagatggggagactgtagcacaaatgatagaagaaaatttgaactgtcttggccattta
agcactattattcatgaagcaaatgaggaacagggcagtagtatgatggtccaaacagaa
aacttgcaaaaagtaacacccataaacctaccacttatagtcaacatctaa

DBGET integrated database retrieval system