KEGG   Felis catus (domestic cat): 101095721
Entry
101095721         CDS       T02385                                 
Symbol
WAS
Name
(RefSeq) wiskott-Aldrich syndrome protein isoform X1
  KO
K05747  Wiskott-Aldrich syndrome protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04062  Chemokine signaling pathway
fca04520  Adherens junction
fca04530  Tight junction
fca04666  Fc gamma R-mediated phagocytosis
fca05135  Yersinia infection
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101095721 (WAS)
   04530 Tight junction
    101095721 (WAS)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101095721 (WAS)
   04062 Chemokine signaling pathway
    101095721 (WAS)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101095721 (WAS)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101095721 (WAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101095721 (WAS)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fca04812]
    101095721 (WAS)
   04990 Domain-containing proteins not elsewhere classified [BR:fca04990]
    101095721 (WAS)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101095721 (WAS)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     101095721 (WAS)
Domain-containing proteins not elsewhere classified [BR:fca04990]
 EVH1 / WASP  homology  (WH) domain-containing proteins
  WH1 domain-containing proteins
   101095721 (WAS)
SSDB
Motif
Pfam: WH1 PBD WH2
Other DBs
NCBI-GeneID: 101095721
NCBI-ProteinID: XP_004000534
Ensembl: ENSFCAG00000018126
UniProt: M3WNI4
LinkDB
Position
X:42760775..42768590
AA seq 501 aa
MSGGPVGGRSGGRGGPGVQQNVPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGQLLWEQELYSQLVYSTPTPYFHTFAGD
DCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPAPANEERRGPPPLPPHP
GGDQGGPAAGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGAP
SGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLE
AVRQEMRRQEPLPPPPPPSRGGNQPPRPPTIGSNKGRSGPLPPVPLGGAPPPPTPRGPPP
PGRGGPPPPPPPATGRSGPPPPPPSGPGGTPVPPPPPPPPPPPPSSDDGPVPPPPPALGP
VGGLAPSGGRGALLDQIRQGIQLNKTPGAPESSALQPPPPRSEGLVGALMHVMQKRSRAI
HSSDEGEDQAGDEDEDDEWDD
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgagtgggggccctgtgggaggcaggtctgggggtcgcggaggaccaggggttcagcag
aacgtaccctccacgctcctccaggaccacgagaaccagcgactcttcgagatgctgggt
cggaaatgctggacactggccaccgccgttgttcagctctacctggcactgcctcccgga
gcagagcactggaccaaggagcattgtggggctgtgtgcttcgtgaaggataacccccag
aagtcctacttcatccgtctttacggccttcaggctggccagctgctctgggaacaggaa
ctgtactcacagttggtctactccactcccaccccctacttccacacttttgctggagat
gactgccaagcagggctgaactttgcagacgagggcgaggcccaggccttccgggccctg
gtgcaggagaagatacaaaaaaggaatcagaggcaaagtggagatagacgccagctaccc
ccaccaccagcaccagccaatgaagagagaagagggcccccacccctgcctccgcaccca
ggtggagaccaagggggcccagcagctggccccctctccctggggctagtaacagtggac
atccaaaacccggacatcacaagttcacgataccgtgggctcccagcacctgggcctggc
ccagctgataagaaacgctcagggaagaaaaagatcagcaaagctgatattggtgcaccc
agtggattcaaacatgtcagccacgtggggtgggacccccagaatggatttgacgtaaac
aacctggacccggatctgcggagtctgttctccagggcaggaatcagtgaggcccagctc
acagatgctgagacctccaagcttatctacgatttcattgaggaccagggtgggctggag
gctgtgcggcaggagatgaggcgccaggagccacttccaccgcccccaccgccatcccga
ggaggaaaccagcccccccggccccctactattgggagcaacaagggtcgttctggtcca
ctgccccctgtacctttgggaggtgctccacccccgccaactccccggggacccccaccc
ccaggccgagggggccctccaccaccaccccctccagccactggacgttctggaccaccg
ccccctccgccctctggacctggagggactcctgtgcctccaccaccaccaccaccacca
ccaccaccacccagctctgatgatgggccagtccctccccctcctcctgctctggggcct
gtggggggcctggcccccagtggaggtcggggggcacttttggatcaaatccggcaggga
attcagctgaacaagacccctggggccccagagagctcagcactgcagcctccacctccg
agatcggaagggttggtgggagccctgatgcacgtgatgcagaagagaagcagagccatc
cactcctcagacgaaggggaggaccaggccggtgatgaggatgaggacgatgagtgggat
gactga

DBGET integrated database retrieval system