KEGG   Felis catus (domestic cat): 101095899
Entry
101095899         CDS       T02385                                 
Symbol
MAP3K7
Name
(RefSeq) mitogen-activated protein kinase kinase kinase 7 isoform X1
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04140  Autophagy - animal
fca04152  AMPK signaling pathway
fca04310  Wnt signaling pathway
fca04380  Osteoclast differentiation
fca04520  Adherens junction
fca04613  Neutrophil extracellular trap formation
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04660  T cell receptor signaling pathway
fca04668  TNF signaling pathway
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05145  Toxoplasmosis
fca05161  Hepatitis B
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101095899 (MAP3K7)
   04310 Wnt signaling pathway
    101095899 (MAP3K7)
   04064 NF-kappa B signaling pathway
    101095899 (MAP3K7)
   04668 TNF signaling pathway
    101095899 (MAP3K7)
   04152 AMPK signaling pathway
    101095899 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101095899 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101095899 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101095899 (MAP3K7)
   04620 Toll-like receptor signaling pathway
    101095899 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    101095899 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    101095899 (MAP3K7)
   04660 T cell receptor signaling pathway
    101095899 (MAP3K7)
   04657 IL-17 signaling pathway
    101095899 (MAP3K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101095899 (MAP3K7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101095899 (MAP3K7)
   05161 Hepatitis B
    101095899 (MAP3K7)
   05171 Coronavirus disease - COVID-19
    101095899 (MAP3K7)
   05162 Measles
    101095899 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    101095899 (MAP3K7)
   05169 Epstein-Barr virus infection
    101095899 (MAP3K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101095899 (MAP3K7)
   05135 Yersinia infection
    101095899 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101095899 (MAP3K7)
   05140 Leishmaniasis
    101095899 (MAP3K7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101095899 (MAP3K7)
   05418 Fluid shear stress and atherosclerosis
    101095899 (MAP3K7)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101095899 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101095899 (MAP3K7)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101095899 (MAP3K7)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  MLK family
   101095899 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 101095899
NCBI-ProteinID: XP_003986428
Ensembl: ENSFCAG00000030907
UniProt: M3WSG5
LinkDB
Position
B2:complement(83948668..84029673)
AA seq 606 aa
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQIPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPSRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgtctacagcctccgccgcttcctcctcttcctcatcttcggccggtgagatgatcgaa
gccccctcccaagtcctcaactttgaagagattgactacaaggagatcgaagtggaagag
gttgttggaagaggagcctttggagtagtctgcaaagctaaatggagagcaaaagatgtt
gccatcaaacaaatagaaagtgaatctgagaggaaagcttttattgtagagcttcgacag
ttatcccgcgtgaaccatcctaatattgtaaagctgtatggggcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattacactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagctctaattcacagggacctgaaaccacca
aacttgttgctggttgcaggggggacagttttaaaaatctgtgactttggtacagcctgt
gacattcagacacacatgaccaataacaagggcagtgctgcttggatggcacctgaagtt
tttgaaggtagcaattacagtgaaaaatgtgacgtcttcagctggggtattatcctttgg
gaagtaataacacgtcggaaaccctttgatgagattggtggcccagctttccgtatcatg
tgggctgttcataatggtactcgaccaccactgatcaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttctcagcgcccttcaatggaggagatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtactcagatgaaggacagagcaattctgccaccagtacaggctcattcatg
gacatcgcttctacaaataccagtaataaaagtgacactaatatggagcaaattcctgca
acaaatgatactattaaacgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatcgggacgtttaagcctgggagcttcccgtgggagcagcgtggagagcttgccc
cccacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagccaggattgct
gcgacaacagcctattccaagcctaaacggggccaccgtaaaactgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtaggtccatc
caagacttgactgttactggaacagaacctggtcaggtaagcagtaggtcatccagtcct
agtgtcagaatgatcactacctcaggaccaacctcagaaaagccaagtcgaagtcatcca
tggactcctgatgattccacagataccaatggatcggataactccatcccaatggcttat
cttacactggatcaccagctacagcctctagcaccgtgcccaaactccaaagaatctatg
gcagtgtttgagcagcattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaaggac
cagcaaaatacatctcgtctggtgcaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttattaccagcaatgtaaaaaacaactagaggtcatcagaagccagcagcaa
aaacgacaaggcacttcatga

DBGET integrated database retrieval system