KEGG   Felis catus (domestic cat): 101095923
Entry
101095923         CDS       T02385                                 
Symbol
PTPN2
Name
(RefSeq) tyrosine-protein phosphatase non-receptor type 2 isoform X3
  KO
K18026  tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101095923 (PTPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101095923 (PTPN2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101095923 (PTPN2)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101095923 (PTPN2)
SSDB
Motif
Pfam: Y_phosphatase DSPc IKKbetaNEMObind
Other DBs
NCBI-GeneID: 101095923
NCBI-ProteinID: XP_011286250
LinkDB
Position
D3:34171835..34258374
AA seq 388 aa
MSATVEREFEELDAENRWQQLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAKRSYILTQGPLPNTGCHFWLMVWQQKTKAVVMLNRVVEKES
VKCAQYWPTKDDREMLFKETGFSVKFLSEDVKSYYTVHLLQLENINSGETRTISHFHYTT
WPDFGVPESPASFLNFLFKVRESGSLNPEHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKG
DDINIKQLLLNMRKYRMGLIQTPDQLRFSYMTIIEGAKFIKGDSNIQKRWKELSKEDLCP
AFDHSPTKIMTEKYNGNRIGLEEEKLTGDRYTGLSSKMQDTMEENSESVLRKRIREDRKA
NTAQKVQQMKQRLNETERKRKRPRLTDT
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtctgccaccgtcgagcgggagtttgaggagttggatgctgagaatcgctggcagcag
ctgtacttggaaattcgcaatgagtcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaatcgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaaa
ctgcaaaatgctgaaaatgattatattaatgccagtttagttgacatagaagaggcgaaa
aggagttacatcttaacacagggtccacttcctaatacaggttgccatttctggctcatg
gtttggcagcaaaagaccaaggcagttgtcatgctaaaccgagttgtggagaaggaatcg
gttaaatgtgcacagtactggccaacaaaagatgaccgagagatgctatttaaagaaaca
ggattcagtgtgaagttcttgtcagaagatgtgaagtcatattatacagtacatctactg
cagttagaaaatatcaatagtggtgaaaccagaacaatatctcactttcactatactacc
tggccagattttggagtccctgaatcaccagcttcatttctcaatttcttatttaaagtg
agagaatctggttccctgaatcctgaacatgggcctgcagtgatccactgtagtgcaggc
attgggcggtcaggcaccttttctctagtagatacctgtcttgttctgatggaaaaagga
gatgatattaacattaaacaactgttactgaatatgagaaaatatcgaatgggacttatt
cagacaccagaccaactcagattctcatatatgactataatagaaggagcaaaatttata
aagggagattcaaatatacagaaacggtggaaagaactctctaaggaagacttatgtcct
gcttttgatcattcaccaaccaaaataatgactgaaaaatacaatgggaataggataggc
ctagaagaagaaaaactgacaggtgacagatacacaggactatcctctaaaatgcaggat
accatggaggagaacagcgagagcgttctacggaaacgtattcgagaggacagaaaagct
aacacggctcagaaggtgcagcagatgaaacagaggctaaatgagactgaacgaaaaagg
aaaaggccaagattgacagacacctaa

DBGET integrated database retrieval system