KEGG   Felis catus (domestic cat): 101096023
Entry
101096023         CDS       T02385                                 
Symbol
BCL3
Name
(RefSeq) B-cell lymphoma 3 protein
  KO
K09258  B-cell CLL/lymphoma 3 protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04625  C-type lectin receptor signaling pathway
fca04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101096023 (BCL3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101096023 (BCL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101096023 (BCL3)
   03110 Chaperones and folding catalysts [BR:fca03110]
    101096023 (BCL3)
Transcription factors [BR:fca03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    101096023 (BCL3)
Chaperones and folding catalysts [BR:fca03110]
 Other chaperones and cochaperones
  Others
   101096023 (BCL3)
SSDB
Motif
Pfam: Ank_2 Ank_3 Ank Ank_4 Ank_5
Other DBs
NCBI-GeneID: 101096023
NCBI-ProteinID: XP_023100954
LinkDB
Position
E2:complement(11823961..11835834)
AA seq 454 aa
MPRCPAGAMDEGPVDLRTRPKAAGPPGAALPLRKRPLRAPSPEPAAPRGAAGPVVTPDPL
GGGSDSPAVPAAPHGLARPEALYYQGPLLPLYPTPTMGSLFPLLNVPTPLYPMVCSVEHP
LSADIAVATRADEDGDTPLHIAVVQGNLPAVHRLVNLFQHGGRELDIYNNLRQTPLHLAV
ITTLPSVVRLLVMAGASPMALDRHGQTAAHLACEHRSPTCLRALLDSAAPGTVDLEARNY
DGLTALHVAVNMECPEAVLLLLERGADIDAVDIKSGRSPLIHAVENNSLSMVQLLLQHGA
NVNAQMYSGSSALHSASGRGLLPLVRTLVRSGADSGLKNCHNDTPLMVARSRRVIDILRG
KATRPAPASQPEPSPDRSATTSPESSSLLSSNGLLSASPSSSPSQSPPKDPPGFPMAPPN
FFLPPSSPPAFLTFAGVLRAPGRPVPPSSAPGGS
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgccccgatgccccgcgggggccatggacgaggggcccgtggacctgcgcacccggccc
aaggccgccgggccccccggcgccgcgctgccgctccgcaagcgcccgctgcgcgcgccc
tccccggaacccgccgccccccgcggcgccgcgggccccgttgtcaccccggatccccta
ggcggcggctccgactccccggcggtccccgcggccccccacggactggcccggccagag
gcgctttactaccagggacctctactgcccctgtacccgaccccgaccatgggctccctc
tttcctctcctgaacgtgcctacacccctgtaccccatggtgtgctccgtggaacatccc
ctatcggctgacatcgccgtggccacccgtgcagatgaggacggagacacgccactccac
attgccgtggtgcagggcaatctgcctgctgtgcatcggcttgtcaacctcttccagcat
gggggccgggagctggatatctacaacaacctacgacagacaccgctacacctggctgtg
atcaccacactgccatctgtggtccggctcctcgtgatggccggtgccagccccatggca
ctggaccgacatggccagacagcagcccacctggcgtgtgagcaccgcagcccgacctgc
ctccgggccctgctggacagcgcagccccgggcaccgtggacctagaggcccgcaattac
gacgggctcaccgccttacacgtggccgtgaacatggagtgccccgaagccgtgctgctc
ttgctggagcgaggcgcagacatcgatgcggtggacattaaaagcggccgctccccactc
atccacgcagtggaaaacaacagcctgagcatggtgcagctcctgctgcagcacggcgcc
aacgtgaacgcgcagatgtactcgggcagctcggcgctgcactccgcgtctggccgcggg
ctcctcccgctcgtgcgcacgctggtccgcagcggcgccgacagtggcctcaagaactgc
cacaacgacacgccgctcatggtggcgcgcagccgccgggtcatcgacatcctgaggggg
aaggcgaccaggcccgctcctgcatcacagccggagccctcgccggaccgcagtgccacc
acctcccctgagagcagtagcctcctcagctccaatggtctcctttctgcatcaccctcc
tcctcgccctcccagtctccccccaaggacccacctggattccccatggctccccccaat
ttcttccttcctccctcatctccacctgccttcctgaccttcgctggggtcctccgagcc
cctggccggccggtgcccccctcttcagctccaggaggcagctga

DBGET integrated database retrieval system