KEGG   Felis catus (domestic cat): 101096264
Entry
101096264         CDS       T02385                                 
Symbol
RAG1
Name
(RefSeq) V(D)J recombination-activating protein 1
  KO
K10628  V(D)J recombination-activating protein 1 [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101096264 (RAG1)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    101096264 (RAG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101096264 (RAG1)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101096264 (RAG1)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101096264 (RAG1)
SSDB
Motif
Pfam: RAG1 RAG1_imp_bd zf-RAG1 zf-C3HC4_2 zf-C3HC4 zf-RING_6
Other DBs
NCBI-GeneID: 101096264
NCBI-ProteinID: XP_019667845
Ensembl: ENSFCAG00000002908
LinkDB
Position
D1:92138404..92147655
AA seq 1043 aa
MAVSLPPALGLSSAPDEIQHPHMKFSEWKFKLFRVRSFEKAPEEAQIEKKISSEGKPSLE
QTPAVLDKADGQKPAPSQPALKAHPTFSKKSHDDGKAGDKAIHQANLRHLCRICGNSFKT
DGHNRSYPVHGPVDGKTQVLLRKKEKRATSWPDLIAKVFRIDVKADVDSIHPTEFCHSCW
NIMYRKFSSAPCEVNFPRNAPMEWHPHTPSCDICHAARRGLKRKSHQPNVQLSKKLKTVV
DRARRARRHKKRARARISSKEVMKKISKCSDIHLSTKLLAVDFPAHFVKSISCQICEHIL
ADPVETSCKHVFCRICILRCLKVMGSYCPCCQYPCFPTDLESPVKSFVSILNSLMVRCPA
KECNEEVSLEKYNHHVSSHKESKETFVHINKGGRPRQHLLSLTRRAQKHRLRELKLQVKA
FADKEEGGDVKSVCLTLFLLALRARNEHRQADELEAIMQGRGSGLQPAVCLAIRVNTFLS
CSQYHKMYRTVKAITGRQIFQPLHALRNAEKVLLPGYYPFEWQPPLKNVSSSTDVGIIDG
LSGLSSSVDDYPVDTIAKRFRYDSALVSALMDMEEDILEGMRAQDLDDYLNGPFTVVVKE
SCDGMGDVSEKHGSGPAVPEKAVRFSFTVMKITVAHGSENVKVFEEVKPNSELCCKPLCL
MLADESDHETLTAILSPLIAEREAMKASNLVLEMGGILRTFKFIFRGTGYDEKLVREVEG
LEASGSVYICTLCDATRLEASQNLVFHSITRSHSENLERYEVWRSNPYHESVEELRDRVK
GVSSKPFIETVPSIDALHCDIGNAAEFYKIFQLEIGEVYKNPNASKEERKRWQATLDKHL
RKKMNLKPIMRMNGNFARRLMTKETVEAVCELIPSEERHEALRELMDLYLKMKPVWRSTC
PAKECPESLCQYSFNSQRFAELLSTKFKYRYEGKITNYFHKTLAHVPEIIERDGSIGAWA
SEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYTSKYLQKFMNAHNAYRNSGFTLN
SQPGVGDPIGLEDSLETQDSMDF
NT seq 3132 nt   +upstreamnt  +downstreamnt
atggctgtctctttgccacccgccctgggactcagttccgccccagatgaaattcagcac
ccgcatatgaaattttcagaatggaaatttaagctcttcagggtgagatcttttgaaaag
gcacctgaagaagctcaaatagaaaagaaaatttcctctgaggggaaaccctctctggag
caaactccagcagtcctggacaaggccgatggtcagaagccagccccgagtcaaccggca
ttaaaagctcaccctacgttttcgaagaaatcccatgatgatgggaaagcaggagacaaa
gcaatccaccaagccaaccttcgccatctctgccgtatctgtgggaattcttttaaaact
gatgggcacaataggagctatccagtccatgggccagtggatggtaaaacccaagtcctt
ttacgaaagaaggaaaagagagccacttcctggccagacctcattgccaaggttttccgg
attgatgtgaaagcagacgttgactcgatccaccccactgaattctgccacagctgctgg
aacatcatgtacaggaagtttagcagtgccccgtgtgaagtcaacttcccaaggaacgca
cccatggagtggcatccccacacgccatcctgtgacatctgccacgctgcccgccgggga
ctcaaaaggaagagccatcagccaaacgtgcagctcagcaaaaaactcaaaaccgtggtt
gaccgagcgagaagagcccgtcggcacaagaaaagagctcgggcaaggatcagcagcaag
gaagtgatgaagaagatctccaagtgcagtgacattcatcttagtaccaagcttctcgcg
gtggacttcccggcacactttgtgaaatctatctcctgccagatttgtgaacacatcctg
gctgaccctgtggagaccagctgtaagcacgtattttgcaggatttgcatcctcaggtgc
ctcaaagtcatgggcagctattgtccctgttgccaatatccctgcttccctaccgacctg
gagagtccagtgaagtcctttgtgagcatcttgaactccctgatggtgagatgtccagca
aaagagtgcaatgaggaggtcagcttggaaaaatataaccaccatgtctcaagccacaag
gagtcaaaagagacttttgtgcatattaataaagggggtcggccccgccagcatctcctg
tccttgacgcgaagggctcagaagcatcgcctgagggagctcaagctgcaagtgaaggct
ttcgccgacaaggaagaaggtggagatgtgaagtctgtgtgtctgaccttgttcctgctg
gcactgagggcgaggaatgagcacagacaagccgacgagctggaggccatcatgcaggga
cggggctctggcctgcagccagctgtgtgcttggccatccgtgtcaacaccttcctcagc
tgcagtcagtaccacaagatgtacaggactgtgaaagccatcacggggaggcagattttt
cagcctttgcacgcccttcggaatgctgagaaggtcctcctgccaggctactaccccttt
gagtggcagccacctctgaagaacgtgtcttccagcactgatgtcggcattattgatggc
ctgtctggactgtcctcctctgtggacgattacccggtggacaccattgccaagcggttc
cgctacgactcggctttggtgtctgctttgatggacatggaagaagatatcctggaaggc
atgagagcccaagacttggatgactacctgaatggccccttcaccgtcgtggtgaaggag
tcttgtgacggcatgggagatgtgagtgagaagcatgggagcgggccagcagttccagaa
aaggcggttcgcttttcgttcacagtcatgaagattaccgtagcgcacggctcagaaaac
gtgaaggtatttgaggaggtcaaacctaactctgaactgtgttgcaagcccttgtgcctc
atgctggcagacgagtctgaccacgagacactgacggccatcttgagccctctcattgcc
gagagggaggccatgaaggccagcaacttagtgctggagatgggaggcatccttcggact
ttcaagttcatcttcaggggcactgggtacgatgagaagcttgtccgggaagttgaaggc
ctcgaggcttctggctcagtctacatttgtaccctttgtgatgccacccgtctggaggcc
tctcaaaatcttgtcttccactccataaccagaagccactctgagaacctggagcgctac
gaggtctggcgttccaacccgtaccacgagtctgtggaagaactgcgggatcgcgtgaaa
ggagtctcatcgaaacctttcattgagaccgtcccttccatagatgcactccactgtgac
attggcaatgcggctgagttctacaagattttccagctagagataggggaggtgtacaag
aatcccaatgcctccaaagaggaaaggaaaaggtggcaggctacgctggacaagcatctc
cggaagaagatgaacctgaagccaatcatgaggatgaatggcaactttgccaggaggctc
atgaccaaagaaacagttgaagccgtctgtgaattaatcccctccgaggagaggcatgaa
gctctcagggagctgatggacctttacctgaagatgaaacccgtgtggcgatcgacatgt
cctgctaaagagtgcccagaatccctctgccagtatagtttcaattcacagcgttttgct
gagctcctctctaccaagttcaagtatcgatatgagggcaaaatcaccaattactttcac
aaaaccttggcacacgtgcctgaaattattgagagagacggctccattggggcctgggca
agcgagggaaatgaatctggcaacaaactgttcaggcgcttccgaaaaatgaatgccaga
cagtccaagtgctacgagatggaagatgtcttgaaacatcactggttgtatacctccaaa
tatctgcagaagtttatgaacgcccataacgcgtatagaaactctgggtttaccttaaac
tcgcagccaggcgtgggggacccaataggcctagaggactctctggaaactcaagattca
atggatttttaa

DBGET integrated database retrieval system