KEGG   Felis catus (domestic cat): 101096277
Entry
101096277         CDS       T02385                                 

Symbol
IL4R
Name
(RefSeq) interleukin-4 receptor subunit alpha
  KO
K05071  interleukin 4 receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05200  Pathways in cancer
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101096277 (IL4R)
   04151 PI3K-Akt signaling pathway
    101096277 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096277 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101096277 (IL4R)
   04658 Th1 and Th2 cell differentiation
    101096277 (IL4R)
   04659 Th17 cell differentiation
    101096277 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101096277 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    101096277 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101096277 (IL4R)
   04090 CD molecules [BR:fca04090]
    101096277 (IL4R)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL2 receptor family
   101096277 (IL4R)
CD molecules [BR:fca04090]
 Proteins
  101096277 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N IL2RB_N1 EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 101096277
NCBI-ProteinID: XP_023102076
Ensembl: ENSFCAG00000023022
LinkDB
Position
E3
AA seq 818 aa
MGRLCSGLTFPVSCLILMWAAGSGSVKVLRAPTCFSDYFSTSVCQWNMDAPTNCSAELRL
SYQLNFMGSENRTCVPENGEGAACACSMLMDDFVEADVYQLHLWAGTQLLWSGSFKPSSH
VKPRAPGNLTVHPNVSHTWLLRWSNPYPPENHLHAELTYMVNISSEDDPTDSRIYNVTYM
GPTLRVAASTLTSGASYSARVRAWAQSYNSTWSEWSPSTKWLNHYEPWEQHLPLGVSISC
LVILAVCLSCYLSVIKIKKEWWDQIPNPAHSHLVAIVIQDPQVSLWGKRSRGQEPAKCSH
WKTCLRKLLPCLLEHGMERKEDPSKIARNGPSQGSGKSAWCPVEVSKTILWPESISVVRC
VELLEAPVESEEEEEEEEEDKGSFCPSPVNLEDSFQEGREGIAARLTESLFMDLLGVEKG
GFGPQGSLESWFPPPSGSAGAQMPWAEFPGPGPQEASPQGKEQPFDPRSDPLATLPQSPA
SPTFPETPPVVTDNPAYRSFGTFQGRSSGPGECDSGPELAGRLGEADPGIPAAPQPSEPP
SALQPEAETWEQILRQRVLQHRGAPAPAPGSGYREFVCAVRQGSTQDSRVGDFGPSEEAG
YKAFSSLLTSGAVCPETSGGEAGSGDGGYKPFQSLTPGCPGAPAPVPVPLFTFGLDAEPP
HCPQDSPLPGSSPEPAGKAQDSHKTPPAPEQAADPLRDDLASGIVYSALTCHLCGHLKQC
HGQEEGGEAHPVASPCCGCCCGDRSSPLVSPLRAPDPLPGGVPLEASLSPASPAPLAVSE
EGPPSLCFQPALSHAHSSSQTPKKVAMLSPEPTCTMAS
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggggcggctttgctctgggctcacgttccctgtgagctgtctgatcctgatgtgggcg
gcaggctctgggagcgtcaaggtcctgcgtgcgcccacctgcttctccgactacttcagc
acctccgtctgccagtggaacatggatgcgcccacgaactgcagcgctgagctccgcctg
tcctaccagctgaacttcatggggtccgaaaaccgcacgtgtgtccctgagaacggagaa
ggcgcggcgtgtgcgtgcagcatgctgatggacgactttgtcgaagcggacgtgtatcag
ctgcacctgtgggcggggacgcagctgctgtggagcggctccttcaagcccagcagtcac
gtgaaacccagggctcccggaaacctcacggttcaccccaacgtctcccacacgtggctg
ctgaggtggagcaacccttacccccctgagaaccacctgcacgccgagctcacctacatg
gtcaacatctcgagtgaagacgaccccacggattccagaatctataatgtgacctacatg
gggcccaccctccgcgtggcagccagcaccctgacgtctggggcttcctacagcgcacgc
gtgagggcctgggctcagagctacaacagcacctggagcgagtggagccccagcaccaag
tggcttaaccactacgagccctgggagcagcacctcccacttggcgtcagcatctcctgc
cttgtcatcctggccgtctgcctgtcctgctacctcagcgtcatcaagattaagaaagaa
tggtgggaccagattcccaaccccgcccacagccacctagtggcgatagtcatccaggac
ccacaggtgtcgctgtggggaaagcggtcccgaggccaggaaccagccaagtgctcacac
tggaagacttgtcttaggaagctcctgccctgtttactggagcacggcatggaaaggaaa
gaggatccctccaagattgccagaaatgggccttcgcagggttctggaaaatcagcatgg
tgccccgtggaggtcagcaagacgatcctctggcccgagagcatcagcgtggtgcgatgt
gtggagctcctggaggccccggtggagagcgaggaggaggaggaggaggaggaggaagat
aaagggagcttctgcccatcgcctgtgaacctcgaggacagcttccaggagggccgggag
ggcatcgcggcccggctgaccgaaagcctcttcatggaccttctcggggttgagaaaggg
ggctttggcccacagggctcgctggaatcgtggtttcctcctccttcgggaagtgcaggt
gctcagatgccctgggctgagtttccgggtccggggccccaggaggcatcgccccagggc
aaggagcagcctttcgacccccggtccgatcctctggccactctgccccagagcccagcc
agcccgactttcccagagacgcccccggtcgtcacagacaaccccgcctaccgcagcttc
gggaccttccagggccggtcctcaggtcccggcgagtgtgactcgggccccgagctggcg
ggacgcctgggggaggcggaccctggcatccccgctgccccccagccttcggagccgcct
tccgcgctccagcccgaggcagagacctgggagcagattctgcgccagcgagtcctgcag
cacaggggggccccggccccggcccccggcagcggctaccgagagtttgtgtgcgccgtg
aggcagggcagcacccaggacagcagggtgggggacttcggcccctcggaggaggccggg
tacaaggccttctcgagtctgctcactagcggtgccgtctgcccagagacgtccgggggt
gaggccggcagtggggacgggggttacaagcccttccagagcctcactcctggctgccct
ggggcccccgccccagtccccgtccccctgttcaccttcggactggacgcggagccacct
cattgcccgcaggactcccccctcccgggcagctccccagagccagcggggaaggcgcag
gacagccacaagaccccgccggccccggagcaggccgcagaccccctccgggacgacctg
gccagcggcattgtctactcagccctcacctgccacctgtgtggccacctgaagcagtgt
cacggccaggaggagggtggcgaggcccaccccgtggccagcccctgctgcggctgctgc
tgtggagacaggtcctcgccgctggtgagccctctgagggccccggaccccctgccaggt
ggggtgcccctggaggccagcctctctccagcctccccggcacccttggctgtctcagag
gagggcccgccctccctgtgcttccagcctgccctgagccatgctcacagctcaagccag
acccccaaaaaggtggccatgctctccccagagcccacgtgcacgatggcttcctag

DBGET integrated database retrieval system