Felis catus (domestic cat): 101096495 Help Entry 101096495         CDS       T02385                                  Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism fca  Felis catus (domestic cat) Pathway fca03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     101096495  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:fca03036]     101096495    03400 DNA repair and recombination proteins [BR:fca03400]     101096495 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      101096495 DNA repair and recombination proteins [BR:fca03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      101096495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone TFIID-31kDa DASH_Dad2 ZapG-like Bromo_TP Motif Other DBs NCBI-GeneID:  101096495 NCBI-ProteinID:  XP_003989531 LinkDB All DBs Position C1:7451974..7461688 Genome browser AA seq 141 aa AA seqDB search MEEDEAAEEQQRFSYQQRLKAAVHYTVGCLCEEVASDREIRFSKQTIAAISELTFRQCEN FAKDLEMFARHAKRSTINTEDVKLLARRSNSLLKYITEKSEELAQFNSEQRAKKKKKLEE ENQKPVEPAEAAAAKKDNSSL NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atggaggaggacgaggcggccgaggagcagcagcgattctcctaccaacagaggctaaaa gcagccgttcactacactgttgggtgtctttgcgaggaagttgcatcggacagagagatt cggttcagcaaacaaaccattgcggccatctcggagctgactttccggcagtgcgaaaat ttcgccaaagacctcgaaatgttcgcaagacacgcgaaaagaagcacaattaacacggaa gatgtgaagctcttagccaggaggagtaattcactgctaaaatacatcacagagaaaagc gaagagctggcacagtttaactcagaacaaagagcaaaaaagaagaagaaattagaggaa gaaaaccaaaaaccagtggagccagcagaggctgcagcagcaaaaaaggacaattcaagt ctgtag

DBGET integrated database retrieval system