KEGG   Felis catus (domestic cat): 101096508
Entry
101096508         CDS       T02385                                 
Name
(RefSeq) E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04144  Endocytosis
fca04910  Insulin signaling pathway
fca05100  Bacterial invasion of epithelial cells
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101096508
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101096508
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101096508
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101096508
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101096508
   05205 Proteoglycans in cancer
    101096508
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    101096508
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101096508
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096508
   04121 Ubiquitin system [BR:fca04121]
    101096508
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101096508
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101096508
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    101096508
SSDB
Motif
Pfam: Cbl_N3 Cbl_N2 Cbl_N Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4
Other DBs
NCBI-GeneID: 101096508
NCBI-ProteinID: XP_023094948
Ensembl: ENSFCAG00000004737
LinkDB
Position
D1:16658834..16722207
AA seq 805 aa
METLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAEL
KGIFPSGLFQGDTFRITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALK
STIDLTCNDYISVFEFDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFI
HKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQ
NPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCL
TSWQESEGQGCPFCRCEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADD
SLFMMKELAGAKVERPPSPFSVAPQASLPPVPPRLDLLQQRVSIPSSASGLGSASKAASG
SLHKDKPLPIPPTLRDLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSR
LGESWLPRPIPKVPVVAPNAGDPWTGRELTNRHSLPFSLPSQMEPRTDVPRLGSTFSVDT
SVNMNNSPLAGSEFEHPKIKPSASASAIYSLAARPLPVPKLPPGEQGESEEDTEYMTPSS
RPLGLPKPDGKWPLDTTQSSRACDCDQQIDSCTYEAMYNIQSQAAPAVTESSTFGEGNLA
PAHASTGPEESENEEDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLEGDPTANFTEG
SQVPERPPKPFPRRINSERKAGSCQQGGAAPAPPQLSSEIENLMSQGYSYQDIQKALVIA
HNNIEMAKNILREFVSISSPAHVAT
NT seq 2418 nt   +upstreamnt  +downstreamnt
atggagacacttggagaaaatgagtattttagggtgttcatggagaatttgatgaagaaa
actaagcagaccataagcctcttcaaggaggggaaagaaagaatgtatgaggagaattct
cagcctaggcgaaacctaaccaaactgtcactgatcttcagccacatgctggcggaacta
aaaggaatctttccaagtggactctttcaaggagacacatttcggattacgaaagcagac
gctgcagaattttggaggaaagcttttggggaaaagacaatagtcccttggaagagtttc
cgacaggcccttcacgaagtgcatcccatcagttccgggctcgaggccatggctctgaaa
tccactattgatctgacctgcaatgattatatttcagtttttgaatttgacatctttaca
agactctttcagccgtggtcctctttgctcaggaactggaacagtcttgctgtaactcat
cccggatacatggctttcctgacgtatgatgaagtaaaagctcggctccagaagttcatt
cacaaacccggaagttacattttccggctcagctgcactcgtctgggtcagtgggctatt
gggtacgtcactgctgacgggaacattctccagacaatcccacacaataaacctctcttt
caagccctgattgacggcttcagggaaggcttctatctgtttccagatggacggaatcag
aatcctgacctgacaggcttgtgtgaaccaactccccaagaccacatcaaagtgacccag
gaacaatatgaattatactgtgagatgggctccacattccaactgtgtaaaatatgtgct
gaaaatgataaggatgtaaaaatcgagccctgtggacacctcatgtgcacgtcctgtctt
acgtcctggcaggaatcagaaggccagggctgtcctttctgccgatgtgaaattaaaggt
actgagcccatcgtggtagatccgtttgaccctagaggaagtggcagcctgctgaggcaa
ggagccgagggagctccctccccaaattatgatgacgatgacgacgaacgagcggatgat
tctctctttatgatgaaggaattggctggtgccaaggtggaacggcctccctctccattt
tcagtggccccgcaagcctcccttcccccggtgccaccgcgacttgaccttctgcaacag
cgggtgtctattccttcaagtgcttctgggcttggaagtgcttctaaggcagcttctggc
tctcttcataaggacaaaccattaccgatacctcccacacttcgagatcttccaccaccg
ccccctccagaccggccatactctgttggagcagaaagccggcctcagagacgccccttg
ccttgcacaccaggcgactgtccgtccagggacaaactgccccctgttccctctagccgc
cttggggaatcatggctgcctcggccgatccccaaagtaccagtggtcgctccaaacgct
ggtgacccctggacaggtagagaattaaccaaccggcactcacttccattttcattgccc
tcacaaatggagcccagaacagatgtgcctaggcttggaagcacattcagtgtggatacc
tccgtgaatatgaataacagcccattagcaggttcagagtttgagcaccccaaaatcaaa
ccttctgcgtctgccagtgccatttattctctggctgccaggcctcttcctgtgccaaag
ctgccccccggggagcagggtgaaagtgaggaggacacggagtatatgaccccctcctcc
aggcctctaggacttccaaaaccggatgggaaatggcctttggacacaacccagagttca
cgagcgtgtgattgtgaccagcagattgatagctgtacatatgaagcaatgtataatatt
cagtcccaggcggcaccggctgtcacagagagcagcacctttggtgaagggaatctggcc
ccggcccacgccagcaccggacccgaggagtctgaaaatgaggaggatggctatgacgtc
cccaagccgcctgtgccggcagtgctggcccggcggactctgtccgacatctctaacgcc
agctcttcgttcggctggttgtctctggaaggcgaccccactgcaaacttcactgagggt
tcccaagttcccgaaaggcctcccaaaccgttccctcggagaatcaactctgaacgaaaa
gcaggtagctgtcagcaaggcggtgccgcccccgccccaccgcagctctccagtgagatt
gagaacctcatgagtcagggatactcctaccaggacattcagaaagctttggtcattgcc
cacaacaacatcgaaatggccaaaaatatcctccgggaatttgtttctatttcttctccc
gcccacgtcgccacctag

DBGET integrated database retrieval system