KEGG   Felis catus (domestic cat): 101096542
Entry
101096542         CDS       T02385                                 
Symbol
TNFSF14
Name
(RefSeq) tumor necrosis factor ligand superfamily member 14
  KO
K05477  tumor necrosis factor ligand superfamily member 14
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04064  NF-kappa B signaling pathway
fca05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101096542 (TNFSF14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096542 (TNFSF14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101096542 (TNFSF14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101096542 (TNFSF14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101096542 (TNFSF14)
   04090 CD molecules [BR:fca04090]
    101096542 (TNFSF14)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Tumor necrosis fators
   101096542 (TNFSF14)
CD molecules [BR:fca04090]
 Proteins
  101096542 (TNFSF14)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 101096542
NCBI-ProteinID: XP_003981774
Ensembl: ENSFCAG00000005040
UniProt: A0A2I2U2B1
LinkDB
Position
A2:complement(4943234..4947430)
AA seq 242 aa
MEETVVRPSVFVVDGQTDIPFTRLGPSRRQRQPCSASQLGLGLLLLLLAAGLAVQGWFLL
QLHWRLGEMVTPLLDGEAESWKQLTQGRRSLQANPAAHLTGANSSLTGSGGPLLWETKLG
LAFLRGLSYRDGSLVIARAGYYYIYSKVQLGGVGCPQGLTSGLPITHGLYKRTPRYPEEL
ELLVSRRSPCGRATGPRVWWDSSFLGGVVHLDAGEEVVVRVPDERLVRLRDGTRSYFGAF
MV
NT seq 729 nt   +upstreamnt  +downstreamnt
atggaggagacggttgtgcggccctcagtgtttgtggtggacggacagacagacatccca
ttcacacggctggggcccagccgccgccaaagacagccctgcagtgcatcccagctgggc
ctgggcctcctgctgctgctgctggctgctgggctggccgtccagggctggttcctgctg
cagctgcactggcgtctgggggagatggtcacacccctgctggatggagaagcagaatcc
tggaagcagctgacccaaggacgaaggtccctccaggccaacccagcagcacacctcaca
ggtgccaactccagcctgacgggcagcgggggcccgctgctctgggagacaaagctgggc
ttggctttcttgaggggcctcagctaccgtgacggctccctggtgattgcccgggctggc
tactattacatctactccaaggtgcagctggggggcgtgggctgcccgcaggggctgacc
agcggcctgcccatcacgcatggcctctacaaacgcacaccgcgctaccccgaggagctc
gagctgctggtcagtcggcggtcaccctgtgggcgagccaccggcccccgcgtctggtgg
gacagcagcttcctgggaggtgtggtgcacctggacgctggcgaggaggtggtcgtccgt
gtgccggatgagcgcctggtccggctccgtgacgggacccgctcctactttggggccttc
atggtgtaa

DBGET integrated database retrieval system