KEGG   Felis catus (domestic cat): 101096633
Entry
101096633         CDS       T02385                                 
Symbol
LYN
Name
(RefSeq) tyrosine-protein kinase Lyn isoform X1
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04062  Chemokine signaling pathway
fca04064  NF-kappa B signaling pathway
fca04611  Platelet activation
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04730  Long-term depression
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05203  Viral carcinogenesis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101096633 (LYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101096633 (LYN)
   04662 B cell receptor signaling pathway
    101096633 (LYN)
   04664 Fc epsilon RI signaling pathway
    101096633 (LYN)
   04666 Fc gamma R-mediated phagocytosis
    101096633 (LYN)
   04062 Chemokine signaling pathway
    101096633 (LYN)
  09156 Nervous system
   04730 Long-term depression
    101096633 (LYN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101096633 (LYN)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101096633 (LYN)
   05169 Epstein-Barr virus infection
    101096633 (LYN)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101096633 (LYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101096633 (LYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096633 (LYN)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101096633 (LYN)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  SRC family
   101096633 (LYN)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    101096633 (LYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 SH3_3 ABC1 Haspin_kinase
Other DBs
NCBI-GeneID: 101096633
NCBI-ProteinID: XP_003999866
LinkDB
Position
F2:10239206..10370929
AA seq 512 aa
MGCIKSKRKDNLNGDGVDLKPQPVRNTDRTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSTKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgggatgtataaaatcaaaaaggaaagacaatctgaatggcgatggagtagatttgaag
cctcaaccagtacgtaatactgaccgaactatttatgtgagagatccaacgtccaataaa
cagcaaaggccagttccagaatctcagcttttaccaggacagaggtttcaaaccaaagat
ccagaggagcaaggagacattgtggtagccttgtacccctacgatggcatccatccagac
gacctgtcgttcaagaaaggagagaagatgaaagtcctggaggaacatggagaatggtgg
aaagctaaatccctttcaacgaagagagaaggtttcatccccagcaactacgtagccaaa
gtcaacaccttggaaacagaagagtggtttttcaaggacataaccaggaaagacgccgaa
aggcagcttctcgcacccgggaacagtgctggggcttttcttatcagagaaagtgaaaca
ttaaaaggaagcttctctctttctgtcagagattatgaccctgtgcatggtgatgttatt
aagcactacaaaattcgaagtctggacaatgggggttattacatctctccacgaatcact
ttcccttgtatcagtgacatgattaagcattaccaaaagcagtcagatggcttgtgcaga
agactggagaaggcgtgtattagtcccaaaccgcaaaagccatgggacaaagacgcctgg
gagatcccgcgggagtccatcaagttggtgaaaaggctcggtgccgggcagttcggggaa
gtctggatgggttactataacaacagtaccaaagtggctgtaaaaaccctgaaaccaggc
accatgtctgtgcaagcattcctggaggaggccaacctcatgaagacccttcagcacgac
aagctggtgaggctgtatgccgtggtcaccagagaggagcctatctacatcatcaccgaa
tacatggccaagggcagtctgctggatttcctgaagagtgacgaagggggcaaagtcctg
cttccaaagctcattgacttctctgctcagatcgcagagggaatggcatacatcgagagg
aagaactacatccaccgagatctacgagcagcgaacgttctggtctctgagtcactcatg
tgcaaaattgcggattttgggctcgctcgcgtgatcgaggacaatgagtacacagcaagg
gaaggtgccaaattccccattaagtggacggctccagaagcgatcaactttggatgtttc
acgattaagtctgatgtgtggtcctttggaattctcctgtatgaaatcgtcacctacggg
aaaattccctacccagggcgaactaatgccgacgtgatgaccgccctgtcgcagggctac
cggatgccccgcatggagaactgccccgacgagctgtatgacatcatgaaaatgtgctgg
aaggaaaaggcagaagagaggccgacgtttgattacttacagagcgtcctggatgatttc
tacacggccacggaagggcagtatcagcagcagccttga

DBGET integrated database retrieval system