KEGG   Felis catus (domestic cat): 101096694
Entry
101096694         CDS       T02385                                 
Symbol
MEFV
Name
(RefSeq) pyrin isoform X1
  KO
K12803  pyrin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101096694 (MEFV)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101096694 (MEFV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096694 (MEFV)
Membrane trafficking [BR:fca04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    101096694 (MEFV)
SSDB
Motif
Pfam: PYRIN PRY SPRY zf-B_box DUF4078 TMPIT
Other DBs
NCBI-GeneID: 101096694
NCBI-ProteinID: XP_006942470
Ensembl: ENSFCAG00000012268
LinkDB
Position
E3:41914644..41928957
AA seq 909 aa
MTLTAPFSPECRVFPVPFPLFHNLSLFTHPLGSRTEAVSDIWLRPFLVNTMIKTPSDHLL
HSLEGLVPNDFERFKFKLQNTSLEKDQSRIPRGQLQKARPVKLATLLITHYGEECAVRLT
LQVLRAINQNFLAEELHKATDPESLIQESGADGSAVSCSSGENKPKGLRIPDVLEGDRQR
QSGDGAPSLPSSQPEAGRGTQKKPQGKRRDQKTSEGLDMLGKPGARNATLSSRKCPFPGK
LQGERGIDPSVRLRRNASSLGRLQGLNCGSLTGSLGRTKSKINEAHLPSVQKRPRSLEIT
IFSGEREVPNPETPLSQEKMRSDNPDSAATLSEVATLNVGATVTPEKGFRNPEHSMSLKG
GAFRNTFPNVSLTRAKTTWEHPESTGPKKNGIAGQEPPEALTEVVDGEFHEPSDPEVPPS
SGKPRDEAVYVLGHAQEGDPVGGTHVRDSCRRSMASRDPKTSDSCSTSWLQSQAPLLVKN
SGDCKQQEGLHMTSLSPKALPQCERHMRQAQLLFCEDHREPICLICRLSQEHRGHRVRPI
EEAALEYKEQIQKQLEYLKDLRKSGEEQRSQGDKKTADFLKQIETRKQRIRHQLKQLYHF
LEEQEKFFMASLEELGQTIGHVRESYSTRASRDIALLNELIGEMEVKQSQPEWELMQDIG
VTLHRAKMVTVPKPWATPPEVEKKMHLFYQKSEFVEKSMKYFSEILHSEMDTINVPELIC
AQTHAVNVILDTETAHPNLIFSNDLKSVRLGNKWDRLPDSPERFDSCIIALGLPSFLSGR
HYWEVEVGNKTGWILGICKASMSRKGNMTLSPDNGYWVVMMTKRSEFQVSTIPPTRLQMT
EPPRRVGIFLDYTTGDISFYNVTNKSVIYTFTSFSCSGPLQPIFSPGTHDGGKNTDPLII
CPVGGQGPP
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgacactcacagctccattttcaccagagtgcagagtgtttcctgtgccttttccgtta
tttcacaacctgtctctttttactcaccctctgggctccaggacagaagctgtttcagac
atctggctccggcctttcctggtcaacaccatgatcaagacccctagtgaccatctgctg
cactccctggaggggctggtgcccaacgactttgagaggttcaagtttaagctccagaac
accagcctggagaaggatcaatcccggatcccccggggccagctccagaaagccaggcca
gtgaagctggccaccctgctgatcacccactatggggaagagtgtgccgtgcggctgacc
ctgcaggtcctgagggccatcaaccagaacttcctggcagaggagctccacaaggcgact
gacccagagtctctgatacaagaaagtggcgcagacggttcagcagtgtcttgttcctcc
ggggagaataagcccaaaggcctgaggataccagatgtcctggaaggtgataggcagcgg
caaagtggtgacggggcccccagtctgccatccagccagcctgaggctggaagggggacc
cagaagaagcctcagggaaaacggagagatcagaagacctccgaaggcctggatatgctg
ggcaagcccggggctaggaacgcgactctgtcctccaggaaatgcccattccctggcaag
ctgcagggggaaagggggatcgatcccagtgtcaggctacgcaggaatgccagctcttta
ggaaggctccaaggactgaactgtgggtcgcttactgggtccctaggaaggacaaaatcc
aaaataaatgaagcacatttaccttctgtacagaagcgccccaggagtcttgaaattacc
attttttcaggagagagagaagtccccaatccagaaactcctctgtctcaagagaaaatg
agaagtgacaatccagactcagcggccaccctcagtgaagtggccactctgaatgtaggg
gctactgtgactccagagaaaggctttaggaatccagagcattccatgagcctgaaaggg
ggagcattcaggaatacatttcccaatgtatcgttgactagagcaaagacgacctgggag
catccagaatctacaggacctaagaaaaacggaattgcgggtcaagaaccccctgaggcc
ttgacagaggtggtagacggtgagttccatgaaccttcagatccagaagttcctccttct
tcagggaagccacgggatgaggctgtgtatgtccttggccatgcccaggaaggagacccg
gttggtggcacgcatgtgcgcgattcctgcagacgctccatggcttccagggatcccaag
acctcagacagctgctcaactagctggctccagagccaggccccactcttggtaaagaac
tcaggagactgcaagcagcaggagggcctgcatatgaccagcttgagccccaaggccctg
ccacagtgtgagcgacatatgaggcaggcccagttgctcttctgcgaggaccacagggag
cctatctgcctcatctgcaggctgagtcaagagcaccgaggccaccgggtgcgccccatc
gaggaggctgccctggaatataaggagcaaattcaaaagcagctggagtatctgaaggac
ttgagaaaatctggggaggaacagagatctcagggggataagaagaccgcggacttcctg
aaacaaatcgaaacccggaagcagagaatccggcaccagctgaagcagctgtaccatttt
ctggaagagcaagagaagttcttcatggcctccctagaggagctgggccagaccattggc
cacgtcagggagtcatacagcacccgagcgtccagagacatcgcccttctcaatgagctg
attggggagatggaggtcaaacagagccagccggaatgggagctcatgcaggacatcgga
gtcaccctgcacagggccaagatggtgactgtccctaagccatgggccactcctccagag
gtggaaaaaaagatgcacttgttctaccagaaatcagagtttgtggagaagagcatgaag
tacttctcggaaattctgcattcagaaatggacaccattaatgttccagaactgatttgc
gctcagacacatgccgttaatgtgattctggacacagaaactgcccaccccaatctcatc
ttctctaatgacctgaaaagcgtgagacttggaaacaagtgggatcgtctgcctgacagt
ccagaaagattcgatagttgcatcattgccctaggccttccaagcttcctctctggccgc
cattattgggaagtggaggtaggaaacaagacagggtggatcctgggtatctgcaaggca
tccatgagcaggaaggggaacatgactctgtcacctgacaatggctattgggtggtgatg
atgacaaagcgaagcgaattccaggtgtccaccattcccccaacgcgcctgcagatgacg
gaaccccccagacgtgtcggcatcttccttgattacaccaccggagacatttccttttac
aatgtaacaaacaaatccgttatctacacattcaccagcttctcttgctctgggcccctt
cagcctatcttcagccctggaacacatgatggagggaagaacacggatcctctgatcatc
tgtccagtgggtggccaggggcctccctga

DBGET integrated database retrieval system