KEGG   Felis catus (domestic cat): 101096877
Entry
101096877         CDS       T02385                                 
Symbol
LCP2
Name
(RefSeq) lymphocyte cytosolic protein 2 isoform X1
  KO
K07361  lymphocyte cytosolic protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04380  Osteoclast differentiation
fca04611  Platelet activation
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101096877 (LCP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101096877 (LCP2)
   04650 Natural killer cell mediated cytotoxicity
    101096877 (LCP2)
   04660 T cell receptor signaling pathway
    101096877 (LCP2)
   04664 Fc epsilon RI signaling pathway
    101096877 (LCP2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101096877 (LCP2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101096877 (LCP2)
SSDB
Motif
Pfam: SH2
Other DBs
NCBI-GeneID: 101096877
NCBI-ProteinID: XP_023115456
Ensembl: ENSFCAG00000000836
LinkDB
Position
A1:181211144..181257356
AA seq 460 aa
MKKEGAFSHANPKSSGFLKRQKAMKKTTGAGHPLKKMTMKAPMTIRRGRTRVTTSPPTRR
RKGRPWKTMRIMSHRPPMMRRLCRTPSCLPSLSPTPTPCTSTGPPPAKSRSSRQCPRRDQ
WPCSLLLLQAGATRHSPHPSPTTKSLAEVETINQQSSPAPSIDRSTKPPLDRSLAPFDRE
PFTLGKKPAFPDKPSAPVGRPLGEHLPKMQKPPLPPATERHDRSSPLPGKKPPVPRHGWG
PDRRENDEDDVHQRPLPQPTMLSMSSNTFPSRSAKLSPKHTLPSPHMPGAFSESNSGFPQ
SASLPPYFSQGLGNRPPPRTESRNFSLPVPNKPRPRSPGEEENSLNEEWYVSYITRPEAE
AALRKINQDGTFLVRDSSKKTITNPYVLMVLYKDKVYNIQIRYQEESQVYLLGTGLRGKE
DFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCMLTHSAGYP
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaagaaagaaggagcattttcacacgcaaaccccaagtccagcggtttcctgaagaga
cagaaagccatgaagaagacaacgggggctggtcatcctttgaagaagatgactatgaaa
gccccaatgacgatcaggagggggaggacgagggtgactacgagtcccccaacgaggagg
aggaaggggcgcccgtggaagacgatgcggattatgagccaccgccctccaatgatgagg
aggctctgcagaactccatcctgcctgccaagcctttctccaactccaactccatgtaca
tcgaccggcccccctccagcaaagtcccgcagcagccgccagtgcccccgcagagaccaa
tggccgtgctccctcctcctcctgcaggccggagccacgcgccactccccccaccccagc
ccaaccacgaagagcctagcagaagtagaaaccataaaccagcaaagctcccctgctcct
tccatagacagaagcacgaaacctcccctcgatcgttcgttagccccatttgacagagag
cccttcacactaggaaagaagccggcgtttcctgacaagccctcggctccagtgggaagg
cctctcggggagcacttacccaagatgcaaaagcctcctttaccgccagccaccgaaagg
catgacagaagtagccccctgccagggaagaagccacctgtgccaaggcatggatgggga
cccgacagaagagagaatgatgaagatgacgtgcatcaaagacctttgcctcagcccaca
atgctctccatgagctccaatacttttccttccagatctgccaagctatcgcccaagcac
accctcccatcacctcacatgcctggagcattctctgaaagtaacagtggtttcccgcag
agtgcctccctgccaccatacttctctcaaggccttggcaatagaccacctcccagaact
gaaagcagaaacttttccttaccagttccaaacaaacctcgaccacggtctcctggggaa
gaagagaactcattaaatgaagagtggtacgtttcttatattacccgaccagaggcggaa
gctgctcttagaaagataaaccaggatggcacttttctcgttagagacagctctaaaaaa
acaataaccaatccatatgtcctcatggtgttgtacaaagataaagtttacaacatccag
atccgttaccaagaggaaagccaagtttacttgttgggaactggactccgaggtaaagag
gactttttgtctgtgtcggatatcatcgactacttcaggaaaatgccacttctgctcatt
gacgggaaaaaccgaggctctagataccagtgcatgttaacgcattctgcaggttatccc
tag

DBGET integrated database retrieval system