KEGG   Felis catus (domestic cat): 101096888
Entry
101096888         CDS       T02385                                 
Symbol
CXCL13
Name
(RefSeq) C-X-C motif chemokine 13
  KO
K10032  C-X-C motif chemokine 13
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096888 (CXCL13)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101096888 (CXCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101096888 (CXCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101096888 (CXCL13)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101096888 (CXCL13)
SSDB
Motif
Pfam: IL8 IRK
Other DBs
NCBI-GeneID: 101096888
NCBI-ProteinID: XP_003985309
UniProt: A0A2I2U3A5
LinkDB
Position
B1:complement(144698048..144704238)
AA seq 100 aa
MRFSLGFLLLMLLVYSITPVHGVLEAFNTNLKCKCVQETSAFIPIQLIEKLQVLPPGNGC
PNKEIIVWKKNKSVVCLNPQAKWILKLIKMLQRKSAVSTP
NT seq 303 nt   +upstreamnt  +downstreamnt
atgaggttctccctgggatttctgcttctcatgctgttggtctacagcatcactccagtc
catggtgttctggaggcctttaacacaaacttaaagtgtaaatgcgtccaagagacctca
gcctttatccccatccaactcattgaaaagcttcaggtcttgcctcctgggaatgggtgc
ccaaacaaagaaatcatagtttggaagaagaataagtcagttgtatgcttgaaccctcaa
gctaaatggatactaaaattaataaaaatgttacagagaaaaagtgctgtttcaactcca
tga

DBGET integrated database retrieval system