Felis catus (domestic cat): 101096911 Help Entry 101096911         CDS       T02385                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism fca  Felis catus (domestic cat) Pathway fca04024   cAMP signaling pathway fca04080   Neuroactive ligand-receptor interaction fca04081   Hormone signaling fca04935   Growth hormone synthesis, secretion and action fca04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     101096911 (SST)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     101096911 (SST)    04081 Hormone signaling     101096911 (SST)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     101096911 (SST)   09154 Digestive system    04971 Gastric acid secretion     101096911 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:fca04052]     101096911 (SST) Cytokines and neuropeptides [BR:fca04052]  Neuropeptides   GPCR binding    101096911 (SST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Somatostatin NLRC4_HD2 Motif Other DBs NCBI-GeneID:  101096911 NCBI-ProteinID:  XP_003991854 UniProt:  M3W6D0 LinkDB All DBs Position C2:79958002..79959506 Genome browser AA seq 116 aa AA seqDB search MLSCRLQCALAALSIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSTNSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgcgctgtccatcgtcctggctctgggc ggtgtcaccggcgcgccctccgatcctcgactccgtcagtttctgcagaagtccctggct gctgccgcggggaagcaggaactggccaagtacttcttggcggagctgctgtctgaaccc aaccagacagagaacgatgccctggaacccgaagacttgtcccaggcggctgagcaggat gaaatgaggctggaactgcagagatccactaactcaaaccctgccatggcaccccgagaa cgcaaagctggctgcaagaatttcttctggaagactttcacttcctgttag

DBGET integrated database retrieval system