KEGG   Felis catus (domestic cat): 101096931
Entry
101096931         CDS       T02385                                 
Name
(RefSeq) C-C motif chemokine 7
  KO
K05509  C-C motif chemokine 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101096931
   04061 Viral protein interaction with cytokine and cytokine receptor
    101096931
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    101096931
   04062 Chemokine signaling pathway
    101096931
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101096931
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101096931
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101096931
NCBI-ProteinID: XP_003996606
Ensembl: ENSFCAG00000013588
UniProt: A0A337RX34
LinkDB
Position
E1:22096953..22098794
AA seq 99 aa
MKVSAALLCLLLTAAAFSLQALAQPEGINSPTTCCYRFTVRKIPIQKLKSYRRITSSYCP
REAVIFKTKQAKELCADPKQKWVQDFMEYLDKKTQTSKL
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagcgcttctgtgcctgctgctcacagctgctgccttcagcctccag
gcacttgctcagccagagggaattaatagcccaaccacctgctgctatagatttaccgtt
agaaagatccccatccagaagctgaagagctacagaagaatcaccagcagctattgtccc
agggaagccgtgatcttcaagaccaaacaggccaaggagctctgtgctgaccccaagcag
aagtgggtccaggatttcatggagtacctggacaagaaaacccaaacctcaaagctatga

DBGET integrated database retrieval system