KEGG   Felis catus (domestic cat): 101097245
Entry
101097245         CDS       T02385                                 
Symbol
PDIA3
Name
(RefSeq) protein disulfide-isomerase A3
  KO
K08056  protein disulfide-isomerase A3 [EC:5.3.4.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04141  Protein processing in endoplasmic reticulum
fca04612  Antigen processing and presentation
fca05163  Human cytomegalovirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101097245 (PDIA3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    101097245 (PDIA3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101097245 (PDIA3)
   05168 Herpes simplex virus 1 infection
    101097245 (PDIA3)
   05163 Human cytomegalovirus infection
    101097245 (PDIA3)
   05169 Epstein-Barr virus infection
    101097245 (PDIA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    101097245 (PDIA3)
   04131 Membrane trafficking [BR:fca04131]
    101097245 (PDIA3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101097245 (PDIA3)
Enzymes [BR:fca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101097245 (PDIA3)
Chaperones and folding catalysts [BR:fca03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101097245 (PDIA3)
Membrane trafficking [BR:fca04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101097245 (PDIA3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101097245 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   101097245 (PDIA3)
  Exosomal proteins of bladder cancer cells
   101097245 (PDIA3)
SSDB
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 OST3_OST6 AhpC-TSA Thioredoxin_3 MTHFR_2
Other DBs
NCBI-GeneID: 101097245
NCBI-ProteinID: XP_003987270
Ensembl: ENSFCAG00000006608
UniProt: M3W668
LinkDB
Position
B3:complement(61845392..61871047)
AA seq 505 aa
MRPRCRALFPGVALLFATARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEEEFEKFISDKDASVVGFFKDLFSDAHSEFLKAASNLRD
NYRFAHTNVESLVNKYDDNGEGITLFRPSHLMNKFEDKTVAYVEQKMTSGKIKKFIQENI
FGICPHMTEDNKDLMQGKDLLVAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGNKLSFA
VASRKTFSHELSDFGLESTAGDIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNDENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLRKDPNIIIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYL
QREATNPPIIQEEKAKKKKKAQEDL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgcgcccccgctgccgagccctgttcccgggcgtggcgctgctattcgccacggcccgt
ctcgccgccgcctccgacgtgctggaactcactgacgacaacttcgagagtcgcatctcg
gacacgggttctgcgggcctcatgctcgtcgagttcttcgccccttggtgtggacactgc
aagaggcttgcccctgagtatgaagctgcagcaaccagattaaaaggaatagtcccatta
gcaaaggttgattgtactgctaacacgaacacctgtaataagtatggagtcagtggatat
ccaaccctgaagatatttagagatggtgaagaagctggtgcttatgatgggcccaggact
gccgatggaattgtcagccacctgaagaagcaggctggaccagcttctgttcctctcagg
actgaggaagaatttgagaagttcattagtgataaagatgcttctgtggtgggttttttc
aaggatttattcagtgatgctcactctgagtttctaaaagcagccagcaacttgagggat
aactaccgatttgcacacaccaatgtggagtctctggtgaacaaatatgatgataatgga
gagggtatcaccttgttccgtccttcacatctgatgaacaaatttgaggacaagactgtg
gcatatgtagaacagaaaatgaccagtggcaagattaaaaaatttatccaagaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttgatgcaggggaaggactta
cttgtggcttactatgatgtggactatgaaaagaatgccaaaggttccaactactggaga
aacagagtgatgatggtagcaaagaaattcctagatgctggaaacaaactcagctttgct
gtagctagccgcaaaacctttagccatgaactttctgattttggcttggaaagcactgct
ggagatattcctgttgttgctatcagaactgcaaaaggagagaagtttgtcatgcaggag
gagttctcacgtgatggcaaggctcttgaaagattcctgcaggattattttgatggcaac
ctgaagagatacctgaagtctgagcccatcccagagagcaatgacgggccagtaaaggta
gtggtagcagagaattttgatgaaatagtgaatgatgaaaataaagatgtgctgattgaa
ttttacgctccttggtgtggtcactgtaagaatctggagcctaagtataaagaactggga
gagaagctcagaaaagacccaaatattatcatagccaagatggatgctacagccaatgat
gtgccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaag
aagctaaacccaaagaaatacgaaggtggccgtgaattaagtgattttattagctatcta
cagcgagaggcaacaaacccccctataattcaagaagaaaaagccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system