KEGG   Felis catus (domestic cat): 101097342
Entry
101097342         CDS       T02385                                 
Symbol
CTNNB1
Name
(RefSeq) catenin beta-1 isoform X1
  KO
K02105  catenin beta 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04310  Wnt signaling pathway
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04520  Adherens junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04670  Leukocyte transendothelial migration
fca04916  Melanogenesis
fca04919  Thyroid hormone signaling pathway
fca04934  Cushing syndrome
fca04936  Alcoholic liver disease
fca05010  Alzheimer disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05100  Bacterial invasion of epithelial cells
fca05132  Salmonella infection
fca05160  Hepatitis C
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101097342 (CTNNB1)
   04310 Wnt signaling pathway
    101097342 (CTNNB1)
   04390 Hippo signaling pathway
    101097342 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101097342 (CTNNB1)
   04520 Adherens junction
    101097342 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101097342 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    101097342 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101097342 (CTNNB1)
   04916 Melanogenesis
    101097342 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101097342 (CTNNB1)
   05205 Proteoglycans in cancer
    101097342 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101097342 (CTNNB1)
   05225 Hepatocellular carcinoma
    101097342 (CTNNB1)
   05226 Gastric cancer
    101097342 (CTNNB1)
   05216 Thyroid cancer
    101097342 (CTNNB1)
   05217 Basal cell carcinoma
    101097342 (CTNNB1)
   05215 Prostate cancer
    101097342 (CTNNB1)
   05213 Endometrial cancer
    101097342 (CTNNB1)
   05224 Breast cancer
    101097342 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101097342 (CTNNB1)
   05163 Human cytomegalovirus infection
    101097342 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101097342 (CTNNB1)
   05165 Human papillomavirus infection
    101097342 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101097342 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    101097342 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097342 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    101097342 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101097342 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101097342 (CTNNB1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101097342 (CTNNB1)
   04934 Cushing syndrome
    101097342 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 101097342
NCBI-ProteinID: XP_003992261
Ensembl: ENSFCAG00000003470
LinkDB
Position
C2:complement(152290502..152332198)
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatctgatggaactggacatggccatggagccagacagaaaagca
gctgtcagtcactggcagcaacagtcttacctggactctggaatccattctggtgccacc
accacagccccttctctgagtggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtacgagtgggaacaggggttttctcagtccttcactcaagaacaagtggct
gatattgatggtcagtatgcgatgacgcgagctcagagagtgcgagctgctatgttccct
gagactttagacgagggcatgcagatcccatccacacagttcgatgctgctcaccctact
aacgtccagcgtttggctgaaccatcacagatgctgaaacacgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccccgaactgacaaaactgcta
aacgatgaagaccaggtggtggttaataaggctgcagttatggtccatcagctttcgaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgccatcgtacgc
accatgcagaatacgaacgacgtggagacagctcgctgtactgctggcaccttgcacaat
ctttctcatcatcgtgagggcttgctggccatctttaagtctgggggcattcccgccctg
gtgaagatgcttgggtcaccagtggattctgtattattttatgccattacaactctccac
aaccttttattgcatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacgacagactgc
cttcagattttagcttacggcaaccaagaaagcaagctgatcattctggctagtggtgga
cctcaagctttagtaaatataatgaggacctacacttacgagaaactactgtggaccaca
agcagagtactgaaggtgctgtctgtctgctctagtaataaaccagctattgtagaagcc
ggtggaatgcaagctttagggcttcacctgacagatccaagtcaacgtctcgttcagaac
tgtctttggactcttaggaatctatcagatgctgcgactaaacaggaagggatggaaggt
cttcttgggacccttgttcagcttctgggctcagatgatataaatgtggtcacctgtgca
gctggaattctttctaatctcacttgcaataattataagaataagatgatggtctgccaa
gtgggtggtatagaggcacttgtgcgtactgtccttcgtgctggtgacagggaggacatc
accgagcctgccatctgtgctcttcgtcatctgaccagtcgacaccaggaagcagagatg
gcccagaatgctgttcgtcttcactatggactaccggttgtggttaaactcctgcaccca
ccatcccattggcctctgataaaggccaccgttggattgattcgaaaccttgccctttgt
ccagcaaatcacgcacctctccgtgaacagggtgccattccacgactagttcagttgctg
gttcgtgcccatcaagatacccagcgccgcacatctatgggcggaacgcagcagcagttt
gtggagggagtccgtatggaagaaattgttgaaggttgtaccggagcccttcatatccta
gctcgggatgttcacaaccgaatcgtaatcagaggactaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagccgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcggaagccattgaagcggagggagccacggctcctctg
acagagctccttcactccagaaacgaaggtgtggcaacatacgcagctgctgttttgttc
cgaatgtctgaggacaagccccaggactacaagaagcggctttcggtggagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagagccccttggatatcgtcaggatgatcccagctaccgttcctttcac
tctggtggatatggccaggatgccttgggtatggacccgatgatggagcacgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcacgcccag
gacctcatggatgggctgcctccaggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system