KEGG   Felis catus (domestic cat): 101097604
Entry
101097604         CDS       T02385                                 

Symbol
TBX21
Name
(RefSeq) T-box transcription factor TBX21
  KO
K10166  T-box protein 21
Organism
fca  Felis catus (domestic cat)
Pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101097604 (TBX21)
   04659 Th17 cell differentiation
    101097604 (TBX21)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    101097604 (TBX21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101097604 (TBX21)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Other transcription factors
   T-box
    101097604 (TBX21)
SSDB
Motif
Pfam: T-box T-box_assoc
Other DBs
NCBI-GeneID: 101097604
NCBI-ProteinID: XP_023099890
Ensembl: ENSFCAG00000010607
LinkDB
Position
E1
AA seq 535 aa
MGIVEPGCGDMLTGTEPMPASDEGRAPGADPQNRYFYPEPGAQDAADRRGGASLGAPYPG
GALVPAPPGRFLGAYAYPPRPQAAGFPGVSEPFPPTASAEGYQPGDGYGAPDPRSVLYPG
PREDYALPAGLEVSGKLRVALNNHLLWSKFNQHQTEMIITKQGRRMFPFLSFTVAGLEPT
SHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGNMPGNRLYVHPDSPNTGAHWMRQEVSFG
KLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEAACNASNTHVFTFQETQFI
AVTAYQNAEITQLKIDNNPFAKGFRENFESMYASVDSSVPSPPGPNCQLLGGDHYSPLLP
NQYPVPSRFYSDLPGQAKDVVSQPYWLGPPRDHSYEAEFRAVSMKPAFLPSAPGPTVSYY
RGQEVLTPGAGWPVAPQYPPKMGPGSWFRPMRTLPMEPGPGASEGRGPEDQGSPSVWTEI
TPLRPESSDSGLGEGDSKRRRVSPYPSSGDSSSPAGAPSPFDKETEGQFYSYFPN
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgggcatcgtggagccgggctgcggagacatgctgacgggcaccgagccgatgccggcg
agcgacgagggccgggcgcccggcgccgacccgcagaaccgctacttctacccggagccc
ggcgcgcaggacgcggccgaccgtcgcgggggcgccagcctgggggcgccgtaccccggg
ggcgccctggtgcccgctccgccgggccgcttcctcggagcctacgcctacccgccccgg
ccccaggccgccggcttccccggggtgagcgagcccttcccgccgacggcgagcgccgag
ggctaccagcctggggacggctatggggccccggacccgcgctcggttctctacccgggg
ccgcgcgaggactacgcgctgccggcggggctggaggtgtccgggaagctgagagtcgcg
ctcaacaaccacctgttgtggtccaagtttaatcagcaccagacggagatgatcatcacc
aagcagggacggcggatgttcccgttcttgtcatttactgtggcggggctggagcccacc
agccattaccggatgttcgtggacgtggtcttggtggaccagcaccactggcggtatcag
agcggcaagtgggtgcagtgtggcaaggctgaaggcaacatgccaggaaaccgcctgtac
gtccacccagattcccccaatactggagcccattggatgcgccaggaagtttcgttcggg
aaactaaagctcacgaacaacaaaggggcctctaacaatgtgacccagatgatcgtgctc
cagtctctccataagtaccagcctcggctacacatcgtcgaggtgaacgatggggagccg
gaggcggcctgcaacgcctccaacacgcatgtcttcaccttccaagagacccagttcatt
gccgtgaccgcctaccagaatgcagagatcactcagctgaaaattgataataaccctttt
gccaaaggattccgggagaactttgagtccatgtatgcctctgttgacagcagcgtcccc
tccccgcctggacccaactgtcagttgcttgggggagaccactactctcctctcctaccc
aaccagtatcccgttcccagtcgcttctactccgaccttcccgggcaagccaaggatgtg
gtttcccagccttactggctggggcccccccgggaccacagctatgaggccgagtttcga
gcggtcagcatgaagcctgcattcctgccctccgcccctggacccaccgtgtcctactac
cgaggccaagaggtcctgacgcctggagctggctggcctgtggccccccagtaccctccc
aagatgggcccaggcagctggttccgccccatgcggactctgcccatggaacccggtccc
ggagcttcagagggacggggcccggaggaccagggctccccctccgtgtggactgagatc
accccgctgcggccggagtccagtgactcaggactgggtgaaggagactctaagaggagg
cgtgtgtccccctatccttccagcggcgatagctcctcccctgctggggccccttctcct
tttgataaggaaaccgaaggccagttttatagctattttcccaactga

DBGET integrated database retrieval system