Felis catus (domestic cat): 101097765 Help Entry 101097765         CDS       T02385                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism fca  Felis catus (domestic cat) Pathway fca04010   MAPK signaling pathway fca04020   Calcium signaling pathway fca04022   cGMP-PKG signaling pathway fca04114   Oocyte meiosis fca04218   Cellular senescence fca04310   Wnt signaling pathway fca04360   Axon guidance fca04370   VEGF signaling pathway fca04380   Osteoclast differentiation fca04625   C-type lectin receptor signaling pathway fca04650   Natural killer cell mediated cytotoxicity fca04658   Th1 and Th2 cell differentiation fca04659   Th17 cell differentiation fca04660   T cell receptor signaling pathway fca04662   B cell receptor signaling pathway fca04720   Long-term potentiation fca04724   Glutamatergic synapse fca04921   Oxytocin signaling pathway fca04922   Glucagon signaling pathway fca04924   Renin secretion fca05010   Alzheimer disease fca05014   Amyotrophic lateral sclerosis fca05020   Prion disease fca05022   Pathways of neurodegeneration - multiple diseases fca05031   Amphetamine addiction fca05152   Tuberculosis fca05163   Human cytomegalovirus infection fca05166   Human T-cell leukemia virus 1 infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05170   Human immunodeficiency virus 1 infection fca05235   PD-L1 expression and PD-1 checkpoint pathway in cancer fca05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101097765 (PPP3R2)    04310 Wnt signaling pathway     101097765 (PPP3R2)    04370 VEGF signaling pathway     101097765 (PPP3R2)    04020 Calcium signaling pathway     101097765 (PPP3R2)    04022 cGMP-PKG signaling pathway     101097765 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101097765 (PPP3R2)    04218 Cellular senescence     101097765 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101097765 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     101097765 (PPP3R2)    04660 T cell receptor signaling pathway     101097765 (PPP3R2)    04658 Th1 and Th2 cell differentiation     101097765 (PPP3R2)    04659 Th17 cell differentiation     101097765 (PPP3R2)    04662 B cell receptor signaling pathway     101097765 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     101097765 (PPP3R2)    04921 Oxytocin signaling pathway     101097765 (PPP3R2)    04924 Renin secretion     101097765 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     101097765 (PPP3R2)    04720 Long-term potentiation     101097765 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     101097765 (PPP3R2)    04380 Osteoclast differentiation     101097765 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101097765 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101097765 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     101097765 (PPP3R2)    05163 Human cytomegalovirus infection     101097765 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     101097765 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     101097765 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     101097765 (PPP3R2)    05014 Amyotrophic lateral sclerosis     101097765 (PPP3R2)    05020 Prion disease     101097765 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     101097765 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     101097765 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101097765 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:fca01009]     101097765 (PPP3R2) Protein phosphatases and associated proteins [BR:fca01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101097765 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  101097765 NCBI-ProteinID:  XP_003995756 LinkDB All DBs Position D4:complement(63502153..63503203) Genome browser AA seq 170 aa AA seqDB search MGNEASYPTEMCSHFNHDEIKRLSKRFKKLDLDCSGSLSVDEFLSLPELRQNPLVQRVID VFDTDGNGEVDFEEFVVGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GNNLQDWQLQQIVDKTIIILDRDGDGRISFEEFSAVVGNLEVHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagctagttacccgacggagatgtgttcccacttcaaccacgatgaaatt aaaaggctgagcaagaggtttaagaagctggacttggactgttcgggctctctgagcgtg gacgagttcttgtccctgcccgagctgcggcagaacccgttggtgcagcgagtgatcgac gtcttcgacaccgacggcaatggagaggtggactttgaggagttcgtcgtggggacctcc cagttcagcgtcaggggggacgaggagcagaagttgaggtttgccttcagcatctacgac atggataaagacggctacatttccaacggggagctgttccaggtgctgaagatgatggtg gggaacaacctgcaagactggcagttacagcagatcgtggacaaaaccatcatcatcctg gacagggatggcgacgggagaatatccttcgaggaattcagtgcggtggtcggaaacctg gaggtccacaagaagttggtggtaattgtgtga

DBGET integrated database retrieval system