KEGG   Felis catus (domestic cat): 101097861
Entry
101097861         CDS       T02385                                 
Symbol
LIMK1
Name
(RefSeq) LIM domain kinase 1
  KO
K05743  LIM domain kinase 1 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04360  Axon guidance
fca04666  Fc gamma R-mediated phagocytosis
fca04810  Regulation of actin cytoskeleton
fca05135  Yersinia infection
fca05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101097861 (LIMK1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101097861 (LIMK1)
  09158 Development and regeneration
   04360 Axon guidance
    101097861 (LIMK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101097861 (LIMK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101097861 (LIMK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101097861 (LIMK1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101097861 (LIMK1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  LISK family [OT]
   101097861 (LIMK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase LIM PDZ Kdo PDZ_6 APH ABC1 Haspin_kinase RIO1 PDZ_2 Pkinase_fungal PknG_TPR
Other DBs
NCBI-GeneID: 101097861
NCBI-ProteinID: XP_023102205
Ensembl: ENSFCAG00000009702
LinkDB
Position
E3:10582157..10607694
AA seq 647 aa
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCECSASLS
HQYYEKDGQLFCKRDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICLTCGTFIGD
GDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSRLPHTVTLVSIPASAHGKRGLSV
SIDPPHGPPGCSTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEID
LLIQETSRLLQLTLEHDPHDTLGHGPGPEPSPLGSPIHTPSGEVGSSSRQKPVLRSYSID
RSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRE
TGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGT
LRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFG
LARLMVEEKTQPEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLC
EIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKL
EQWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgaggttgacgctactttgttgcacctggagggaagaacgtatgggagaggaaggaagt
gagttgcccgtgtgtgcgagctgcggccagaggatctatgacggccagtacctccaggcc
ctgaatgctgactggcacgcagactgcttcaggtgttgtgagtgcagtgcctctctctcg
caccagtactacgagaaggatgggcagctcttctgcaagagggactattgggcccgctat
ggagagtcctgccatgggtgctcggagcacatcaccaaggggctggtcatggtggccggg
gagctgaaataccacccggagtgtttcatctgcctcacgtgcgggaccttcatcggtgac
ggggacacctacaccctggtggagcactccaagctgtactgcggccactgctactaccag
actgtggtgacccccgtcatcgagcagatcctgcccgactcccccggctcccgcctgccc
cacacagtcaccctagtatccatcccagcctcggctcatggcaaacgtggcctctcggtc
tccatcgaccccccgcacggcccgccgggctgcagcacagagcactcccacaccgtccgc
gtccagggagtggacccaggctgcatgagcccagatgtgaagaactccatccacgtcgga
gaccggatcctggaaatcaatggcacgcccatccgcaacgtgcccctggatgagattgat
cttctgatccaggaaaccagccgcctgctccagctaactcttgagcacgacccacatgac
acactgggccatgggccagggcctgagcccagccccctgggctctccaatccacactccc
agcggggaggtgggcagctcttcccggcagaagcctgtcctgaggagctacagcatcgac
aggtccccaggtgctggctccctgggctccccggcctcccagcgcaaggacctgggtcgc
tctgaatccctccgtgtggtctgccggccgcaccgaatcttccggccgtcggacctcatc
cacggggaggtgttgggcaaaggctgcttcggccaggccatcaaggtgacgcacagggag
acgggcgaggtgatggtgatgaaggagctgatccggtttgacgaagagacacagaggaca
ttcctcaaggaggtgaaggtcatgcgatgcctggagcaccccaatgtgctcaagttcatc
ggcgtgctctataaggacaagagactcaacttcatcactgagtacatcaaggggggcacc
ctccgtggcatcatcaagagcatggacagccagtacccgtggagtcagagagtgagcttt
gccaaggatatcgcttcagggatggcctacctccactccatgaacatcatccaccgggac
ctcaactcccacaactgcctggtccgagagaacaagaacgtggtggtggccgactttggg
ctggcacggctcatggtggaagagaagacacagcccgaagacctgcgaagcctcaagaag
ccagaccgcaaaaagcgctacacggtggtgggcaacccgtactggatggcgcctgagatg
atcaacggccgcagctacgatgagaaggtggatgtgttttcctttggaatcgtcctgtgt
gagatcattgggcgggtgaacgctgaccctgactacctaccccgcaccatggactttggc
ctcaacgtgcgaggcttcctggaccgctattgccccccaaactgcccgccgagcttcttc
cccattaccgtgcgctgctgtgatctggaccccgagaagagaccctccttcgtgaagctg
gaacaatggctggagaccctccgcatgcacttggccggccacctgccactgggcccgcag
ctggagcagctggaccggggcttctgggagacctaccggcgtggtgagagtggactgcct
gcccaccccgaggtccccgactga

DBGET integrated database retrieval system