KEGG   Felis catus (domestic cat): 101098338
Entry
101098338         CDS       T02385                                 
Symbol
PLAU
Name
(RefSeq) urokinase-type plasminogen activator
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04610  Complement and coagulation cascades
fca05202  Transcriptional misregulation in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101098338 (PLAU)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101098338 (PLAU)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101098338 (PLAU)
   05206 MicroRNAs in cancer
    101098338 (PLAU)
   05205 Proteoglycans in cancer
    101098338 (PLAU)
  09162 Cancer: specific types
   05215 Prostate cancer
    101098338 (PLAU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101098338 (PLAU)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101098338 (PLAU)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     101098338 (PLAU)
Peptidases and inhibitors [BR:fca01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101098338 (PLAU)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   101098338 (PLAU)
SSDB
Motif
Pfam: Trypsin Kringle DUF316 Trypsin_2 NFACT-R_1
Other DBs
NCBI-GeneID: 101098338
NCBI-ProteinID: XP_006937958
Ensembl: ENSFCAG00000015567
UniProt: M3WMV1
LinkDB
Position
D2:36474589..36480457
AA seq 441 aa
MRILMTCLLLCVLVVSDSEGSHELHPVSDASNCGCLNGGTCVSYKYFSNIQRCSCPKKFQ
GEHCEIDTSKTCYQGNGHSYRGKANTDIVGRPCLAWNSAAVLLKEYHALRSDALQLGLGK
HNYCRNPDNQRKPWCYVQVGLNQLVQQCMVHDCSFGKRPLSPPGKSPLSPPKTAEFQCGQ
KALRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYLCGGSLISPCWVVSATHCFINNP
KKEDYIVYLGRSKLNSDTLGQMKFEVENLILHEDYSADTLAHHNDIALLKIRSNTGQCAQ
PSRSIQTICLPPSYGDAHFGTSCEITGFGKENTTDYLYPEQLKMTSVKLISYQECQQPHY
YGSEITTKMLCAADPQWETDSCQGDSGGPLVCSIHGRLTLTGIVSWGSGCAMKDKPGVYT
RVSGFLPWIQRHTGEQNGLDL
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgagaatcctgatgacctgcctgctcctctgtgtcctggtggtgagcgactccgaaggc
agccacgaacttcatccagtgtctgatgcatcaaactgcggctgcctgaatggaggaaca
tgtgtgtcctacaagtacttctccaacattcagcgatgcagctgtccaaagaaattccaa
ggagaacactgtgagatagatacatcgaaaacctgctatcaggggaatggtcactcttac
cgagggaaggccaacaccgacatcgtgggccggccctgcctggcctggaactctgctgcc
gttcttctgaaagagtaccatgccctccgatctgatgcccttcagctgggcctggggaaa
cacaattattgcaggaacccggacaaccagagaaagccatggtgctatgtgcaggttggc
ttaaaccagcttgtccaacagtgcatggtgcacgactgctcttttggaaaacgtcccctg
tctcctccaggaaaaagtcccctgtctcctccaaaaacagcagagtttcagtgtggccag
aaggctctgaggcctcgctttaagattattgggggagaattcaccaccatcgagaaccag
ccttggtttgcagccatctataggaggcaccgtggaggctctgtcacctacttgtgcgga
ggcagcctcatcagtccttgctgggtggtcagcgccacacattgcttcattaataacccg
aagaaggaggactacattgtctacctgggtcggtcaaagcttaactctgatacacttggg
cagatgaagtttgaagtggaaaatctcatcttgcatgaggactatagtgctgacactctt
gctcaccacaatgatatcgccttgctgaagatcagatccaacacaggccagtgtgcacag
ccatccaggtccatacaaaccatctgtttgcccccatcgtatggtgatgctcattttggc
acaagctgtgagatcactggctttggaaaagagaataccactgactatctctatccagag
cagctgaaaatgacttctgtgaagctgatttcctaccaggagtgtcagcagccccactac
tacggctctgaaatcaccaccaaaatgctgtgtgctgctgacccacaatgggaaacagat
tcctgccagggagactctgggggccctctggtctgctctatccacggccgcctgactctg
actgggattgtgagctggggcagtggatgtgccatgaaggacaagccgggcgtctacaca
agagtctcaggcttcctgccttggatccaaaggcacactggggagcagaatggcctagac
ctgtga

DBGET integrated database retrieval system