KEGG   Felis catus (domestic cat): 101098389
Entry
101098389         CDS       T02385                                 
Symbol
M6PR
Name
(RefSeq) cation-dependent mannose-6-phosphate receptor
  KO
K10089  cation-dependent mannose-6-phosphate receptor
Organism
fca  Felis catus (domestic cat)
Pathway
fca04142  Lysosome
fca04145  Phagosome
fca05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101098389 (M6PR)
   04142 Lysosome
    101098389 (M6PR)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101098389 (M6PR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101098389 (M6PR)
   04091 Lectins [BR:fca04091]
    101098389 (M6PR)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101098389 (M6PR)
Lectins [BR:fca04091]
 P-type lectins
  101098389 (M6PR)
SSDB
Motif
Pfam: Man-6-P_recep ATG27 CIMR
Other DBs
NCBI-GeneID: 101098389
NCBI-ProteinID: XP_003988430
Ensembl: ENSFCAG00000015280
LinkDB
Position
B4:complement(43503966..43513656)
AA seq 278 aa
MFPFCSCWRTGLLLPLLLAVAVRESWQTEEKTCDLVGDKGRESETELALLKRLQPLYNKS
FESTVGQGPDTYIYMFRVCREAGNRTSGAGLVQINKSNGKETVVGRLNETHIFNGSNWIM
LTYKGGDEYDRHCGMEQRRAVVMISCNRHTLADNFNPVSEERGKVQDCFYLFEMDSSLAC
APEISRLSVGSILLVTFASLVAVYVIGGFLYQRLVVGAKGMEQFPHLAFWQDLGNLVADG
CDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
NT seq 837 nt   +upstreamnt  +downstreamnt
atgttccccttctgcagctgctggaggactgggctgctcctgccactgctcctggctgtg
gcagtaagagaatcctggcagacagaagaaaaaacctgcgacctggtgggagacaagggt
agagagtcagagacagagttggctctactgaagaggctgcagccactgtataacaaaagc
tttgagagcactgtgggccagggcccagatacatatatctacatgttcagggtgtgccga
gaagctggcaaccgtacctctggggcaggcctggtgcagatcaacaaaagtaacggcaag
gagacagtggtagggagactcaacgagacccacatcttcaatggaagtaattggatcatg
ctgacctataaagggggtgatgaatacgacaggcactgcggcatggagcagcgtcgtgca
gtggtgatgatctcctgcaatcgacacaccctagcggacaattttaaccctgtgtctgag
gagcgaggcaaagtccaagattgtttctacctcttcgagatggacagcagcctggcctgt
gccccggagatctcccgcctcagtgtgggttctatcttactagtcacgtttgcatcactg
gtcgcagtctacgtcatcggggggttcctataccagcgactggtggtgggagccaaggga
atggagcagtttcctcacctcgccttctggcaagatcttggcaacctggtagcagatggt
tgtgactttgtgtgccgttctaaaccccgaaatgtgcctgctgcgtatcgtggtgtgggg
gatgatcagctgggggaagagtcagaagaaagggatgatcatttattaccaatgtga

DBGET integrated database retrieval system