KEGG   Felis catus (domestic cat): 101098635
Entry
101098635         CDS       T02385                                 
Symbol
SIN3A
Name
(RefSeq) paired amphipathic helix protein Sin3a
  KO
K11644  paired amphipathic helix protein Sin3a
Organism
fca  Felis catus (domestic cat)
Pathway
fca04919  Thyroid hormone signaling pathway
fca05016  Huntington disease
fca05169  Epstein-Barr virus infection
fca05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101098635 (SIN3A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101098635 (SIN3A)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    101098635 (SIN3A)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101098635 (SIN3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101098635 (SIN3A)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     101098635 (SIN3A)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101098635 (SIN3A)
SSDB
Motif
Pfam: Sin3a_C PAH Sin3_corepress
Other DBs
NCBI-GeneID: 101098635
NCBI-ProteinID: XP_003986977
Ensembl: ENSFCAG00000011363
UniProt: M3WEZ5
LinkDB
Position
B3:33004843..33080765
AA seq 1274 aa
MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTP
SYQVSAVPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQR
LKVEDALSYLDQVKLQFGSQPQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIM
GFNTFLPPGYKIEVQTNDMVNVTTPGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQ
PAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQ
PVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYA
QVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRP
NQNGCQIRRHSGTGATPPVKKKPKLLSLKDSSMADASKHGVGTESLFFDKVRKALRSAEA
YENFLRCLVIFNQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETFPKERAT
EGIAMEIDYASCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVS
SKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGG
TSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWRE
QNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAGVPVGPHLSL
AYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEE
EEMDVDEATGAAKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLH
QILCLRLLRICSQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYY
PAFLDMVRSLLDGNIDSSQYEDSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQ
VTDLYLAENNNGATGGQLNTQTSRSLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTI
ELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLARKPVFLPRNLRRIRKCQRG
REQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSH
ERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSI
NKYRVKYGTVFKAP
NT seq 3825 nt   +upstreamnt  +downstreamnt
atgaagcgacgtttggatgaccaggagtcaccggtgtatgcggcccagcagcgtcggatc
cctggtagcacagaggcttttcctcaccagcaccgggtacttgcccctgcccctcctgta
tatgaagcagtgtctgagaccatgcagtcagccacgggaattcagtactctgtgacaccc
agctatcaggtttcagcagtgccacagagctctggcagtcacgggcccgccatcgcagcg
gttcacagcagccatcatcacccaacagctgtgcagccccacggaggccaggtggtccag
agtcatgctcatccagccccaccagttgcaccagtgcagggacagcagcagtttcagagg
cttaaggtggaggatgcgctgtcctatcttgaccaggtgaagctgcagtttggtagtcag
cctcaggtctacaatgatttccttgacatcatgaaggaatttaaatctcagagcattgac
actccaggagtgattagtcgtgtgtcccagctgttcaaaggccaccccgacctgattatg
ggcttcaataccttcttgccccctggctacaagattgaggtgcaaaccaatgacatggtg
aacgtgacaactcctggccaggttcatcagatccctacccatggcatccagccccagcct
cagccaccaccccaacatccttcccagccttcagcccagtcagccccagctcctgcccag
ccagctcctcagcccccacctgccaaagtcagcaagccttcccaactacaagcacatact
ccagccagtcagcagactccccctctcccaccatatgcatccccgcgttctccacctgtc
cagcctcatacaccagtgacaatctcattgggaacggccccatccttgcagaacaatcag
cctgtggagtttaatcacgccatcaactatgttaataaaatcaagaacaggttccagggc
caaccagacatctacaaagcgttcctggagattttgcacacatatcagaaagagcagcga
aatgccaaggaagctggaggaaactacactccagcattgaccgagcaggaggtgtatgcc
caggtggctcgtctttttaaaaatcaggaagatctgttgtcagagtttggacagttccta
ccagatgccaacagctctgtgcttttaagcaaaaccacagctgagaaggttgattctgtg
agaaatgaccatggaggcactgtgaagaagccccagctgaacaacaagccacagaggccc
aaccagaatggctgccagatccgaaggcactctggaacgggagccacccctccggtgaag
aagaaacctaaactgctcagcctaaaggattcttctatggcagatgccagtaaacatggt
gtaggaaccgagtcgttattttttgataaggtccgaaaggctctgcggagtgctgaggcc
tatgaaaatttcctgcgctgtcttgttatctttaaccaggaggtgatctctcgggctgag
cttgtccagttagtctctcctttcctggggaaattccctgaattgtttaattggtttaaa
aactttctgggctataaggagtctgtacatctggaaacctttccaaaggaacgagccaca
gagggcattgccatggagatagattatgcctcttgtaaacggttgggctccagctatcgg
gccctaccaaagagttaccagcagcccaagtgtacaggacggactcctctctgtaaagag
gttttaaatgatacgtgggtttccttcccttcctggtctgaggactccacctttgttagt
tccaagaaaacccagtatgaagaacatatctatcgttgtgaagatgaacgctttgagctt
gatgtagttttagagaccaatctggcaacgatccgggttctggaagcaattcagaagaag
ctctctcgcttgtctgctgaggaacaagccaaatttcgcttggacaacacccttgggggc
acgtcggaagttattcatcgaaaagcactccagaggatatatgctgataaagcagctgac
atcattgacggtctgaggaagaacccctccatcgctgtcccaattgtccttaaaaggttg
aagatgaaagaggaagaatggcgggaagctcagagaggctttaacaaggtgtggagagag
cagaatgagaagtactacttgaagtctctggaccaccagggcatcaactttaaacagaat
gacaccaaggtcctgaggtctaagagtttactcaacgagattgagagtatctatgatgag
aggcaggagcaggctacagaagaaaatgccggtgtacctgtcggcccacacctctcgctt
gcctatgaagacaaacagatcctggaagatgccgctgctttgattatccaccatgtgaag
aggcagacgggcattcaaaaggaggacaagtataaaatcaagcaaatcatgcatcatttc
attccagatctgctctttgctcagagaggtgatctctcggatgtggaggaagaggaagaa
gaagagatggatgtagatgaagccacaggggcagctaagaagcacaatggtgttgggggc
agtccccctaagtctaagctactgtttagtaacacagcagctcagaagttaagagggatg
gatgaagtatacaacctcttctatgttaataacaactggtatatctttatgcgactgcac
cagattctctgcttgcggctgctgcggatttgttcccaagctgaaagacaaattgaagaa
gaaaaccgagagagagagtgggaacgggaagtgttgggcataaagcgagacaagagtgac
agtcctgctatccagttgcgtctcaaagaacctatggatgttgatgtagaagattattac
ccagctttcctggacatggtgcggagcctgctagatggcaacatagactcgtcacagtac
gaagattcgctgagagagatgttcaccattcacgcctacattgccttcaccatggacaaa
ctaatccagagcattgtcagacagctgcagcacattgtgagtgacgagatctgtgtacag
gtgactgacctttacctggcagaaaacaataatggggccacaggaggccagctgaacaca
cagacctccaggagtctcctggagtcaacatatcagcggaaggctgagcaactcatgtca
gatgagaattgctttaagcttatgtttattcagagccaaggccaggttcagctgaccatt
gagctcctggacacagaagaggagaactcggatgaccctgtagaagcagagcgttggtca
gactatgtggagcgatacatgaactctgatactacctctcctgagctgcgtgagcatctg
gcacggaaaccagtatttctcccgaggaatctgaggcggatccggaaatgtcagcgtggt
cgagaacagcaggaaaaggaagggaaggaaggaaacagcaagaagaccatggagaatgtg
gatagcctggataaactggagtgtagattcaagttgaattcctacaagatggtgtatgtg
atcaagtcagaggactacatgtatcggagaactgccttgctccgggctcatcagtcccat
gagcgtgtaagcaagcggctacatcagaggttccaggcctgggtagataaatggaccaag
gagcatgtgccccgtgaaatggcagcagagaccagcaagtggctcatgggtgaggggctg
gagggcctggtgccctgtaccaccacctgtgacacagagaccctgcactttgtgagcatt
aacaagtaccgtgtcaaatatggcacagtgttcaaagccccataa

DBGET integrated database retrieval system