Felis catus (domestic cat): 101098924 Help Entry 101098924         CDS       T02385                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism fca  Felis catus (domestic cat) Pathway fca04015   Rap1 signaling pathway fca04810   Regulation of actin cytoskeleton fca05014   Amyotrophic lateral sclerosis fca05132   Salmonella infection Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101098924 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101098924 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101098924 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101098924 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101098924 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:fca04812]     101098924 (PFN3)    04147 Exosome [BR:fca04147]     101098924 (PFN3) Membrane trafficking [BR:fca04131]  Others   Actin-binding proteins    Others     101098924 (PFN3) Cytoskeleton proteins [BR:fca04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101098924 (PFN3) Exosome [BR:fca04147]  Exosomal proteins   Proteins found in most exosomes    101098924 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101098924 NCBI-ProteinID:  XP_003981258 LinkDB All DBs Position A1:172797066..172797839 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISGVLRDQRIDDVAIMGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QAGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKTVHELINGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggggactggaaaggctatatcagtggagtgctgcgggaccagcgtattgatgacgtg gccatcatgggccactcagacaatcgctgcgtgtgggcatcgcgccctggaggccttcta gctgccatatcaccgcaggaggtgggtgtgctcacagggcctgatcggcacaccttcctg caggccggcctgagtgtggcaggccgccgctgctgcgtcatccgagaccacctgctgtct gagggagatggtgtcctggacgctcgcactaaagggctggatgggcgtgctgtctgcgtg ggccacaccccgcgcgcgctcctggtgctcatgggccgacggggtgtgcatgggggcatc ctcaacaagacagtgcatgagctgatcaatgggctacgcaagcagggcacatag

DBGET integrated database retrieval system