KEGG   Felis catus (domestic cat): 101099031
Entry
101099031         CDS       T02385                                 
Symbol
IL5RA
Name
(RefSeq) interleukin-5 receptor subunit alpha isoform X1
  KO
K05067  interleukin 5 receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101099031 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101099031 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101099031 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099031 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101099031 (IL5RA)
   04090 CD molecules [BR:fca04090]
    101099031 (IL5RA)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   101099031 (IL5RA)
CD molecules [BR:fca04090]
 Proteins
  101099031 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 101099031
NCBI-ProteinID: XP_011278466
Ensembl: ENSFCAG00000000652
LinkDB
Position
A2:complement(44889535..44924754)
AA seq 417 aa
MAPALLILLGATVILSADSLSDKKSLLLPPTNFTIKVTGLSQVLLRWESNPDQEPVNIEL
GYHVRINAPQEEDYETRNTESKRVTVLHKGFSASVQTVPWNGQPLPPSRWVSAELKAPPG
SPGTSIVNLTCTTNTTVNNHTPLRPYQVSLHCSWLAGKDAPEDTQYFLYYRYGSWTEECQ
EYRRDTLNRNTACWFPKTFISSRGSEALAVHANGSSKHAPIKPFDQLFALHAIDRINPPV
NVTAEIEGTCLSIQWEKPVSAFPIHCFEYEVKIYNTRKKYFQTEKLMTNAFISIIDDISK
YSVQVRATVSSMCRQMGFWSEWSQPIYVGSDDQKPSTEWFLIVLMAAICFILLIFSFICK
TGHLWTRLFPPVPAPKSSIQDFFVIVSSEKTVSTETEIEVISYVEDPGFETLEDSVF
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcacctgcattactgattctcttgggggctacagtgatactgagcgcagactcactt
tctgataaaaaatctttacttctcccacctaccaacttcactatcaaagttactggcctt
tcccaagttcttttgcgttgggaatcaaatcctgatcaagagccagtgaatatagagcta
ggctatcatgtgagaataaatgctccacaagaagaagactacgaaaccaggaacactgaa
agcaaacgtgtaaccgttcttcataaaggcttttcagcaagtgtgcagacggtcccttgg
aacggccagcccctcccaccaagccgctgggtttctgctgaacttaaagccccacctggg
tctcctggaacctcgattgtgaatttaacatgtaccacaaacaccacagtgaataatcat
actcccttaaggccataccaagtttctcttcactgctcctggctagctggcaaggatgcc
cctgaggatacacagtattttctctactataggtatgggtcctggaccgaagaatgccag
gagtacaggagagacaccctgaacagaaatactgcatgctggtttccaaagacttttatc
agcagcagaggaagtgaggcactcgcagtgcatgctaatggctcaagcaagcatgcacca
atcaagccttttgatcagctgtttgctcttcatgcaatcgatcgcattaatcctccagtg
aatgtcacagcagagattgaaggaacctgtctttcaattcagtgggaaaaaccagtttct
gcctttccaattcactgctttgaatatgaagtgaaaatttacaacacaaggaaaaaatat
ttccagacagaaaaactgatgacgaatgcattcatctcaataattgatgatatttctaag
tattccgttcaagtgagagccaccgtgagttctatgtgcagacagatggggttttggagc
gagtggagtcaacctatatacgtgggaagtgatgaccagaagccctccacagaatggttt
cttatcgtgcttatggcggccatctgcttcatcttgctaattttctccttcatctgtaaa
acaggtcacttatggaccaggttgtttccaccagttccggcaccaaaaagtagtattcaa
gatttctttgtcatcgtcagctctgagaaaactgtttccactgaaacagaaattgaagtc
ataagttatgtggaagaccctggatttgagaccctggaagattctgtgttttga

DBGET integrated database retrieval system