KEGG   Felis catus (domestic cat): 101099133
Entry
101099133         CDS       T02385                                 
Symbol
FRS2
Name
(RefSeq) fibroblast growth factor receptor substrate 2
  KO
K12461  fibroblast growth factor receptor substrate 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04714  Thermogenesis
fca04722  Neurotrophin signaling pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101099133 (FRS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101099133 (FRS2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101099133 (FRS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:fca04990]
    101099133 (FRS2)
Domain-containing proteins not elsewhere classified [BR:fca04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   101099133 (FRS2)
SSDB
Motif
Pfam: IRS
Other DBs
NCBI-GeneID: 101099133
NCBI-ProteinID: XP_023112995
Ensembl: ENSFCAG00000030509
LinkDB
Position
B4:96434037..96543964
AA seq 508 aa
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDASSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKHRTSVHVPLEARISNAESNTPKEEPSSIEDRDP
QILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVGGSGANSTEWDTGYDSDERREAPS
VNKLVYENINGLSIPSASGVRRGRLTSSSTSDTQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVTVPASAHKIEFSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSSLQKALPRDDGTSRKTRHNSTDLPM
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgggtagctgttgtagctgtccagataaagacactgtcccagataaccatcggaacaag
tttaaggtcattaatgtggatgatgatgggaatgagttaggttctggcattatggaactt
acagacacagaactgattttatacactcgcaaacgtgattcagtaaaatggcactacctc
tgcctgcggcgctatggctatgattcaaatctcttttcttttgaaagtggtcgaaggtgt
caaactggacaaggaatcttcgcctttaagtgtgctcgtgcagaagaattatttaacatg
ttgcaagagattatgcaaaataatagtataaatgtggtggaagagccagttgtagaaagg
aataatcatcagacagagttggaagtccccagaacacctcgaacaccgacaactccaggg
tttgctgctcagaatttacctaatggatatcccagatatccctcatttggagatgcttcc
tcgcatccttcaagcagacatccttctgtgggaagtgcacgcctgccttcagtgggtgaa
gaatctactcatcctttgcttgtggctgaggagcaagtccatacctatgtcaacaccaca
ggagtgcaggaagagcggaaacaccgcacaagcgtgcacgtcccattggaggcgaggatc
tctaatgctgaaagcaacacaccaaaagaagaaccaagtagtattgaggacagggaccct
cagattcttctcgaacctgaaggagtcaaatttgtcttaggaccaacccctgttcaaaag
cagttaatggaaaaagagaaactggagcaacttggaagagaccaagtcggtgggagtggt
gcaaacagcacggaatgggacactgggtatgacagcgatgagcgcagagaggcaccctct
gtgaacaaactggtgtatgagaatataaatgggttatctatccctagtgcctcaggggtc
aggagaggtcgtctgacatccagcagtacctcagatacccagaatatcaacaactcagct
cagagaagaactgcattattaaactatgaaaatttaccatctttgcctcctgtttgggaa
gcccgcaagctaagtagggatgaagatgacaatttaggaccaaagaccccatctctaaat
ggctaccataataatctagatccaatgcataactatgtaaatacagagaatgtaacagtg
ccggcaagtgctcacaaaatagagttttccaggcgtcgggactgtacgccgacggtcttt
aactttgatatcaggcgcccaagtttagaacacaggcagctcaattacatacaggtcgac
ttggaaggtggcagtgactctgacaaccctcagactccaaaaacgcctaccactcccctt
ccacagacccctaccaggcgcacagagctgtatgctgtgatcgacatcgagagaactgct
gctatgtcaagtttgcagaaagcactgccacgagacgatggcacatctaggaagactaga
cataatagtactgatctgcccatgtga

DBGET integrated database retrieval system