Felis catus (domestic cat): 101099307 Help Entry 101099307         CDS       T02385                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism fca  Felis catus (domestic cat) Pathway fca04014   Ras signaling pathway fca04015   Rap1 signaling pathway fca04020   Calcium signaling pathway fca04022   cGMP-PKG signaling pathway fca04024   cAMP signaling pathway fca04070   Phosphatidylinositol signaling system fca04114   Oocyte meiosis fca04218   Cellular senescence fca04261   Adrenergic signaling in cardiomyocytes fca04270   Vascular smooth muscle contraction fca04371   Apelin signaling pathway fca04625   C-type lectin receptor signaling pathway fca04713   Circadian entrainment fca04720   Long-term potentiation fca04722   Neurotrophin signaling pathway fca04728   Dopaminergic synapse fca04740   Olfactory transduction fca04744   Phototransduction fca04750   Inflammatory mediator regulation of TRP channels fca04910   Insulin signaling pathway fca04912   GnRH signaling pathway fca04915   Estrogen signaling pathway fca04916   Melanogenesis fca04921   Oxytocin signaling pathway fca04922   Glucagon signaling pathway fca04924   Renin secretion fca04925   Aldosterone synthesis and secretion fca04970   Salivary secretion fca04971   Gastric acid secretion fca05010   Alzheimer disease fca05012   Parkinson disease fca05022   Pathways of neurodegeneration - multiple diseases fca05031   Amphetamine addiction fca05034   Alcoholism fca05133   Pertussis fca05152   Tuberculosis fca05163   Human cytomegalovirus infection fca05167   Kaposi sarcoma-associated herpesvirus infection fca05170   Human immunodeficiency virus 1 infection fca05200   Pathways in cancer fca05214   Glioma fca05417   Lipid and atherosclerosis fca05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:fca00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     101099307    04015 Rap1 signaling pathway     101099307    04371 Apelin signaling pathway     101099307    04020 Calcium signaling pathway     101099307    04070 Phosphatidylinositol signaling system     101099307    04024 cAMP signaling pathway     101099307    04022 cGMP-PKG signaling pathway     101099307  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101099307    04218 Cellular senescence     101099307  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101099307   09152 Endocrine system    04910 Insulin signaling pathway     101099307    04922 Glucagon signaling pathway     101099307    04912 GnRH signaling pathway     101099307    04915 Estrogen signaling pathway     101099307    04921 Oxytocin signaling pathway     101099307    04916 Melanogenesis     101099307    04924 Renin secretion     101099307    04925 Aldosterone synthesis and secretion     101099307   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     101099307    04270 Vascular smooth muscle contraction     101099307   09154 Digestive system    04970 Salivary secretion     101099307    04971 Gastric acid secretion     101099307   09156 Nervous system    04728 Dopaminergic synapse     101099307    04720 Long-term potentiation     101099307    04722 Neurotrophin signaling pathway     101099307   09157 Sensory system    04744 Phototransduction     101099307    04740 Olfactory transduction     101099307    04750 Inflammatory mediator regulation of TRP channels     101099307   09159 Environmental adaptation    04713 Circadian entrainment     101099307  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101099307   09162 Cancer: specific types    05214 Glioma     101099307   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     101099307    05163 Human cytomegalovirus infection     101099307    05167 Kaposi sarcoma-associated herpesvirus infection     101099307   09171 Infectious disease: bacterial    05133 Pertussis     101099307    05152 Tuberculosis     101099307   09164 Neurodegenerative disease    05010 Alzheimer disease     101099307    05012 Parkinson disease     101099307    05022 Pathways of neurodegeneration - multiple diseases     101099307   09165 Substance dependence    05031 Amphetamine addiction     101099307    05034 Alcoholism     101099307   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101099307    05418 Fluid shear stress and atherosclerosis     101099307  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:fca01009]     101099307   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fca04131]     101099307    03036 Chromosome and associated proteins [BR:fca03036]     101099307   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fca04147]     101099307 Protein phosphatases and associated proteins [BR:fca01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101099307 Membrane trafficking [BR:fca04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     101099307 Chromosome and associated proteins [BR:fca03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      101099307 Exosome [BR:fca04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101099307 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EH Dockerin_1 EF_EFCAB10_C Temptin_C EFhand_Ca_insen EF-hand_11 Caleosin DUF5580_M SurA_N_3 SurA_N_2 Motif Other DBs NCBI-GeneID:  101099307 NCBI-ProteinID:  XP_006933271 UniProt:  A0A2I2U5U0 LinkDB All DBs Position B4:5183454..5184737 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQVAEFREAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLRGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDD EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgacagaggaacaggtggccgagttcagggaggccttctgcctgttc gacaaggacggggacggcgccatcaccacccaggagctgggcaccgtcatgcggtccctg ggccagaaccccacggaggccgagctccgggacatggtgggcgagatcgaccgtgacggc aacggctccgtggacttccccgagttcctgggcatgatggcccggcagctgaggggcagg gacagcgaggagcagatccgggaggccttccgcgtgttcgacaaggacggcaacggcctg gtgagcgcggccgagctgcggcacgtgatgaccaggctcggggagaagctgagcgacgac gaggtggacgagatgatccgggccgccgacgtggacggggacggccaggtcaactacgag gagttcgtgcacatgctggtctccaagtga

DBGET integrated database retrieval system