KEGG   Felis catus (domestic cat): 101099307
Entry
101099307         CDS       T02385                                 
Name
(RefSeq) calmodulin-like protein 3
  KO
K02183  calmodulin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04114  Oocyte meiosis
fca04218  Cellular senescence
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04728  Dopaminergic synapse
fca04740  Olfactory transduction
fca04744  Phototransduction
fca04750  Inflammatory mediator regulation of TRP channels
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04970  Salivary secretion
fca04971  Gastric acid secretion
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05133  Pertussis
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05214  Glioma
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101099307
   04015 Rap1 signaling pathway
    101099307
   04371 Apelin signaling pathway
    101099307
   04020 Calcium signaling pathway
    101099307
   04070 Phosphatidylinositol signaling system
    101099307
   04024 cAMP signaling pathway
    101099307
   04022 cGMP-PKG signaling pathway
    101099307
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101099307
   04218 Cellular senescence
    101099307
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101099307
  09152 Endocrine system
   04910 Insulin signaling pathway
    101099307
   04922 Glucagon signaling pathway
    101099307
   04912 GnRH signaling pathway
    101099307
   04915 Estrogen signaling pathway
    101099307
   04921 Oxytocin signaling pathway
    101099307
   04916 Melanogenesis
    101099307
   04924 Renin secretion
    101099307
   04925 Aldosterone synthesis and secretion
    101099307
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101099307
   04270 Vascular smooth muscle contraction
    101099307
  09154 Digestive system
   04970 Salivary secretion
    101099307
   04971 Gastric acid secretion
    101099307
  09156 Nervous system
   04728 Dopaminergic synapse
    101099307
   04720 Long-term potentiation
    101099307
   04722 Neurotrophin signaling pathway
    101099307
  09157 Sensory system
   04744 Phototransduction
    101099307
   04740 Olfactory transduction
    101099307
   04750 Inflammatory mediator regulation of TRP channels
    101099307
  09159 Environmental adaptation
   04713 Circadian entrainment
    101099307
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101099307
  09162 Cancer: specific types
   05214 Glioma
    101099307
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101099307
   05163 Human cytomegalovirus infection
    101099307
   05167 Kaposi sarcoma-associated herpesvirus infection
    101099307
  09171 Infectious disease: bacterial
   05133 Pertussis
    101099307
   05152 Tuberculosis
    101099307
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101099307
   05012 Parkinson disease
    101099307
   05022 Pathways of neurodegeneration - multiple diseases
    101099307
  09165 Substance dependence
   05031 Amphetamine addiction
    101099307
   05034 Alcoholism
    101099307
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101099307
   05418 Fluid shear stress and atherosclerosis
    101099307
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101099307
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101099307
   03036 Chromosome and associated proteins [BR:fca03036]
    101099307
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101099307
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101099307
Membrane trafficking [BR:fca04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    101099307
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     101099307
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101099307
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EH Dockerin_1 EF_EFCAB10_C Temptin_C EFhand_Ca_insen EF-hand_11 Caleosin DUF5580_M SurA_N_3 SurA_N_2
Other DBs
NCBI-GeneID: 101099307
NCBI-ProteinID: XP_006933271
UniProt: A0A2I2U5U0
LinkDB
Position
B4:5183454..5184737
AA seq 149 aa
MADQLTEEQVAEFREAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG
NGSVDFPEFLGMMARQLRGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDD
EVDEMIRAADVDGDGQVNYEEFVHMLVSK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgaccagctgacagaggaacaggtggccgagttcagggaggccttctgcctgttc
gacaaggacggggacggcgccatcaccacccaggagctgggcaccgtcatgcggtccctg
ggccagaaccccacggaggccgagctccgggacatggtgggcgagatcgaccgtgacggc
aacggctccgtggacttccccgagttcctgggcatgatggcccggcagctgaggggcagg
gacagcgaggagcagatccgggaggccttccgcgtgttcgacaaggacggcaacggcctg
gtgagcgcggccgagctgcggcacgtgatgaccaggctcggggagaagctgagcgacgac
gaggtggacgagatgatccgggccgccgacgtggacggggacggccaggtcaactacgag
gagttcgtgcacatgctggtctccaagtga

DBGET integrated database retrieval system