KEGG   Felis catus (domestic cat): 101099869
Entry
101099869         CDS       T02385                                 
Symbol
SKAP2
Name
(RefSeq) src kinase-associated phosphoprotein 2
  KO
K23471  src kinase-associated phosphoprotein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101099869 (SKAP2)
SSDB
Motif
Pfam: PH SH3_1 SH3_9 SH3_2 PH_9 PH_3 PH_11 PH_13 PH_8
Other DBs
NCBI-GeneID: 101099869
NCBI-ProteinID: XP_003982924
Ensembl: ENSFCAG00000025910
UniProt: M3WRR0
LinkDB
Position
A2:complement(120141584..120324066)
AA seq 354 aa
MPNPSSTSSPYPLPEEIRNLLADVETFVADTLRGENLSKKAKEKRESLIKKIKDVKSIYL
QEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAHSEGNQFPPIAAQDLPFVLKA
GYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYNVRMNNTLRKD
AKKDCCFEISAPDKRIYQFTAASPKDAEQWVQQLKFVLRDMGSDVIPEDNDERGELYDDV
DHPLPTSSQPPDDEIYEELPEEEEDSAPANVEDQRKTSQDSALPATGDKSTDYANFYQGL
WDCTGALSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgcccaaccccagcagcacctcctctccctaccccctccctgaggaaattaggaacctg
ttggcagatgttgaaacatttgtagcagacacactgagaggggaaaatttatccaagaaa
gcaaaggaaaagagagaatcccttattaagaagataaaagatgtgaagtctatctatctt
caggaatttcaagacaaaggtgatgcagaagatggggaagagtatgatgacccttttgct
ggacccccagacactatttcgttagcctcggaaagatatgataaagatgacgaagcccat
tctgaaggaaaccagtttcctccaattgcagcacaggaccttccttttgttttaaaggct
ggctaccttgagaaacgcagaaaagatcacagctttctgggattcgaatggcagaaacgg
tggtgtgccctcagcaaaactgtattctattattatggaagtgataaagacaagcaacag
aaaggtgaattcgcaatagacggctacaatgtcagaatgaataacactctcaggaaggat
gcaaagaaggattgctgttttgaaatctctgctcctgataaacggatctatcagttcaca
gcagcgtctcccaaagatgctgagcagtgggtacagcagctgaaatttgtattacgcgac
atgggatctgatgttattcctgaagacaacgacgaaagaggggaattgtatgatgacgtg
gaccatcctctgccaaccagcagccagccacctgatgatgaaatttatgaagaacttcca
gaagaggaagaggacagtgctcccgcaaacgtggaggaccaaaggaagacgagtcaggac
agtgctctccccgccacaggagataaaagcaccgattatgctaatttttaccagggtttg
tgggactgcacaggagctctttctgatgagttgtcatttaaacgtggtgatgtgatttac
attctcagcaaggaatacaatagatatggctggtgggtaggagaaatgaagggagccatt
ggcttggtgccgaaagcctacataatggagatgtatgatatttga

DBGET integrated database retrieval system