KEGG   Felis catus (domestic cat): 101099880
Entry
101099880         CDS       T02385                                 
Symbol
CXCL11
Name
(RefSeq) C-X-C motif chemokine 11
  KO
K12672  C-X-C motif chemokine 11
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101099880 (CXCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101099880 (CXCL11)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101099880 (CXCL11)
   04062 Chemokine signaling pathway
    101099880 (CXCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101099880 (CXCL11)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101099880 (CXCL11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101099880
NCBI-ProteinID: XP_023108805
Ensembl: ENSFCAG00000023938
LinkDB
Position
B1:146137267..146139246
AA seq 100 aa
MSVKGMVIVLAVIFCATIVQGFPMFKGGRCLCIGPGVKAVKVADIEKATIIYPSNNCNKI
EVIITLKAHKGQRCLNPKSKQANIIIKKIKRMNFLKYQDV
NT seq 303 nt   +upstreamnt  +downstreamnt
atgagtgtgaagggcatggttatagtcttggctgtgatattctgtgctacaattgttcaa
ggtttccccatgttcaaagggggacgctgtctttgcataggccctggagtaaaagcagtg
aaagtggcagatattgagaaagccaccataatttacccaagtaacaactgtaacaaaata
gaagtgattatcaccttgaaagcacataaaggacaaagatgcctaaatcccaaatcgaag
caagcaaacattataatcaagaaaattaaaagaatgaattttttaaaatatcaagatgta
tga

DBGET integrated database retrieval system