KEGG   Felis catus (domestic cat): 101100011
Entry
101100011         CDS       T02385                                 
Symbol
CCL1
Name
(RefSeq) C-C motif chemokine 1
  KO
K05514  C-C motif chemokine 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100011 (CCL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101100011 (CCL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101100011 (CCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101100011 (CCL1)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101100011 (CCL1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101100011
NCBI-ProteinID: XP_003996619
Ensembl: ENSFCAG00000008332
UniProt: A0A2I2UC63
LinkDB
Position
E1:complement(22148318..22151721)
AA seq 94 aa
MKLITVALVCLLLAGMWLREADSRSMHVSSSNCCFTFVEKKISSQRIQCYKNTSSACSRS
SLIIKLKGGRETCVLPTARWVKQSLKSKKPCLLK
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaagctcatcaccgtggccctggtgtgcctgctgctggctgggatgtggctgcgcgag
gcggacagcaggagcatgcacgtatcgtcctccaactgttgcttcacgtttgtggagaag
aagatttcctcgcagagaatccagtgttacaaaaacaccagctccgcgtgctcccgcagt
agtctaataatcaagctgaagggaggcagagagacctgtgtcttgccgacagcccgatgg
gttaagcaatctttaaagtccaagaaaccatgcctgctaaagtaa

DBGET integrated database retrieval system