KEGG   Felis catus (domestic cat): 101100131
Entry
101100131         CDS       T02385                                 
Symbol
CXCL10
Name
(RefSeq) C-X-C motif chemokine 10
  KO
K12671  C-X-C motif chemokine 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca05160  Hepatitis C
fca05164  Influenza A
fca05169  Epstein-Barr virus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101100131 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100131 (CXCL10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101100131 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101100131 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    101100131 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    101100131 (CXCL10)
   04657 IL-17 signaling pathway
    101100131 (CXCL10)
   04062 Chemokine signaling pathway
    101100131 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    101100131 (CXCL10)
   05171 Coronavirus disease - COVID-19
    101100131 (CXCL10)
   05164 Influenza A
    101100131 (CXCL10)
   05169 Epstein-Barr virus infection
    101100131 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101100131 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101100131 (CXCL10)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101100131 (CXCL10)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Chemokines
   101100131 (CXCL10)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 101100131
NCBI-ProteinID: XP_003985323
UniProt: A0A2I2UFH1
LinkDB
Position
B1:146169700..146171976
AA seq 98 aa
MNQRAVLIFCLIFLTLSGIQGIPLSRTPRCTCIKISELSVNLRSLEKLEVIPASHFCPRV
EIIATMKKNGEKTCLNPESKTIKNLVKAISKERSKRSP
NT seq 297 nt   +upstreamnt  +downstreamnt
atgaaccaacgagctgttcttattttctgtcttatctttctgactctgagtggaattcaa
ggaatacctctctctagaacaccacgctgtacctgtatcaagattagtgaactatctgta
aatctaaggtccttagaaaaacttgaagtgattcctgcaagtcacttttgtccacgtgtt
gaaatcattgctacaatgaaaaagaatggggagaaaacatgcctgaatccagagtctaag
accatcaagaatttagtgaaagcaattagcaaggaaaggtctaaaagatctccttga

DBGET integrated database retrieval system