KEGG   Felis catus (domestic cat): 101100225
Entry
101100225         CDS       T02385                                 
Symbol
IRAK4
Name
(RefSeq) interleukin-1 receptor-associated kinase 4 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04722  Neurotrophin signaling pathway
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05133  Pertussis
fca05135  Yersinia infection
fca05140  Leishmaniasis
fca05142  Chagas disease
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05171  Coronavirus disease - COVID-19
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101100225 (IRAK4)
   04064 NF-kappa B signaling pathway
    101100225 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101100225 (IRAK4)
   04621 NOD-like receptor signaling pathway
    101100225 (IRAK4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101100225 (IRAK4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101100225 (IRAK4)
   05161 Hepatitis B
    101100225 (IRAK4)
   05171 Coronavirus disease - COVID-19
    101100225 (IRAK4)
   05164 Influenza A
    101100225 (IRAK4)
   05162 Measles
    101100225 (IRAK4)
   05168 Herpes simplex virus 1 infection
    101100225 (IRAK4)
   05169 Epstein-Barr virus infection
    101100225 (IRAK4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101100225 (IRAK4)
   05135 Yersinia infection
    101100225 (IRAK4)
   05133 Pertussis
    101100225 (IRAK4)
   05152 Tuberculosis
    101100225 (IRAK4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101100225 (IRAK4)
   05140 Leishmaniasis
    101100225 (IRAK4)
   05142 Chagas disease
    101100225 (IRAK4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101100225 (IRAK4)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101100225 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101100225 (IRAK4)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101100225 (IRAK4)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: TKL group
  IRAK family
   101100225 (IRAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Haspin_kinase Death ABC1
Other DBs
NCBI-GeneID: 101100225
NCBI-ProteinID: XP_006933689
Ensembl: ENSFCAG00000021974
UniProt: A0A337S8S7
LinkDB
Position
B4:73192873..73217943
AA seq 460 aa
MNKPITSSTYVRSLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLVQNEFFAPASLLLPDAVPQTVNTLPAKEAVTI
PQKELPLCGKDRTFVLPVQDLEQNYMPPDSSSPENTSLAGSDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGCVNNKTVAVKKLAAMVDISTEELKQQFDQEIKVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDDTPPLSWHMRCKIAQGAATGIS
FLHENHHIHRDIKSANILLDEDFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITAKSDIYSFGVVLLEIITGLPAVDEYREPQLLLDIKEEIEDEEKTIEDYIDTKMKD
SDPISIETMYSVASQCLHEKKNKRPDIKKVQQLLQDMTVS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaataaacccataacatcttcaacatatgtgcgctccctcaatgttggactaatcagg
aagctgtcagattttattgatcctcaagaaggatggaagaagttagcggtagctattaaa
aaaccatctggtgatgatagatacaatcagtttcacataaggagatttgaagcattactt
caaactggaaaaagccccacttgtgaattactgtttgactggggtaccacaaattgcaca
gttggtgatcttgtggatcttttggtccaaaatgagttttttgccccagcaagtcttttg
ctaccagatgctgttccccaaactgttaatacactacctgctaaagaagctgtaacaatt
ccgcagaaagaattgcctctctgtggcaaagacaggacatttgtgttacctgtgcaggat
cttgaacaaaactatatgccccctgactcctcaagtccagaaaatacaagtttagcaggg
agtgatacacgttttcacagcttttcattttatgaattgaagaatgtcacaaataacttt
gatgaaaggcccatttctgtcggtggcaacaagatgggagagggcgggtttggagttgtg
tataaaggctgcgtgaacaacaaaactgtagcagtgaagaagcttgcagcaatggttgac
attagtactgaagaactgaaacagcagtttgatcaagaaataaaagttatggcaaagtgt
caacatgaaaacttagtagaactacttggtttctcaagtgatggagatgacctctgctta
gtgtatgtttacatgcccaatgggtcattgctggacaggctgtcctgcttggatgatact
ccaccactttcatggcatatgagatgcaagattgctcagggtgcagctactggcatcagt
tttttacatgaaaaccatcatattcatagagacattaaaagtgcaaatatcttactagat
gaagactttacagccaaaatatcagactttgggcttgcacgggcttctgagaagtttgcc
caaacagtcatgactagcagaattgtgggaacaacagcttatatggcacctgaggcttta
cgaggagaaataacagccaaatctgacatatacagctttggtgtggttttattagaaata
ataactggacttccagctgtagatgaataccgtgaacctcagttattgctagatattaaa
gaagaaatcgaagatgaagaaaagacaattgaagattatattgatacgaagatgaaagac
agtgatcccatttccattgaaaccatgtattctgttgccagtcaatgcttgcatgaaaag
aaaaataagagaccagatattaagaaggttcaacagctgctgcaagacatgacagtttct
tga

DBGET integrated database retrieval system