KEGG   Felis catus (domestic cat): 101100307
Entry
101100307         CDS       T02385                                 
Symbol
CCR6
Name
(RefSeq) C-C chemokine receptor type 6
  KO
K04181  C-C chemokine receptor type 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100307 (CCR6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101100307 (CCR6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    101100307 (CCR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:fca03037]
    101100307 (CCR6)
   04030 G protein-coupled receptors [BR:fca04030]
    101100307 (CCR6)
   04050 Cytokine receptors [BR:fca04050]
    101100307 (CCR6)
   04090 CD molecules [BR:fca04090]
    101100307 (CCR6)
Cilium and associated proteins [BR:fca03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   101100307 (CCR6)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    101100307 (CCR6)
Cytokine receptors [BR:fca04050]
 Chemokine receptors
  CC Chemokine
   101100307 (CCR6)
CD molecules [BR:fca04090]
 Proteins
  101100307 (CCR6)
SSDB
Motif
Pfam: 7tm_1 Peptidase_C53
Other DBs
NCBI-GeneID: 101100307
NCBI-ProteinID: XP_011280849
LinkDB
Position
B2:152769814..152799042
AA seq 376 aa
MNGEPMNISDVFGLSEDYFGSGNNSSDYSLDDNTLLCSLQEVRTFSGLFVPIAYSLICVF
GLLGNVLVVVTFAFYKKAKSMTDVYLLNMAIADILFVLTLPFWAVSHATGEWIFSNAMCK
LMKGIYAVNFNCGMLLLTCVSMDRYIAIVQATKSFRLRSRTLAHRRAICFVVWVASVLIS
AWTFTFNQKYDVHGSHVCEPRYQAVSDPIKWKLLMLGLQLLFGFFIPLVFMIFCYMFIVK
TLVQAQNSKRHKAIRVIIAVVLVFLACQIPHNMVLLVTAAQLGRMNRSCQGARLLGYSQN
VTEVLAFLHCCLNPVLYAFIGQKFRSYFLKIVKDLWCVRRKQKASGFSCSRLHSEAFTSR
QNSETADNDNASSFTM
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaacggggaaccgatgaacatcagcgacgtcttcggtctgagtgaggattactttggg
tcgggtaataatagctcggattactcactcgatgacaacacgttactgtgctccctgcag
gaggtcagaacgttctctgggctgtttgtgcccatcgcttactccctgatctgcgtcttt
ggcctcctgggcaatgttttggtggtggtcacctttgctttctacaagaaagccaagtct
atgacagacgtgtacctcttgaacatggccatcgccgacatactttttgtcctcaccctc
ccgttctgggccgtcagccacgccaccggcgagtggatcttcagcaacgccatgtgcaag
ctgatgaagggcatctacgccgtcaacttcaactgcgggatgctgctcctgacctgcgtc
agcatggaccgctacattgccatcgtccaggccaccaagtccttcaggctgcggtccagg
acgctggcgcaccgcagggccatctgcttcgtggtctgggtggcttccgtcctcatctcc
gcctggacgttcacgttcaaccagaagtacgacgtgcacggcagccacgtgtgcgagccc
cggtaccaggcggtctcggaccccatcaagtggaagctgctgatgctggggctccagctc
ctcttcggcttcttcatcccgctggtgtttatgatcttttgctacatgttcatcgtcaaa
accctggtgcaggctcagaactccaagcggcacaaggccatccgcgtgatcatcgcggtg
gtgctggtgttcctggcttgccagatcccccacaacatggtgctcctggtgacggccgcg
cagctgggcaggatgaaccgctcctgccagggcgccaggctgctgggctacagccagaac
gtcaccgaggtcctggccttcctgcactgctgtctcaaccccgtgctctatgccttcatc
ggccagaagtttcggagctacttcctgaagatcgtgaaggacctgtggtgtgtgcggagg
aagcagaaggcgtcgggcttctcctgctccaggctgcactcggaggccttcacctccagg
cagaacagcgagaccgcggacaacgacaacgcgtcgtcgttcaccatgtga

DBGET integrated database retrieval system