KEGG   Felis catus (domestic cat): 101100388
Entry
101100388         CDS       T02385                                 
Symbol
CXCL9
Name
(RefSeq) C-X-C motif chemokine 9
  KO
K05416  C-X-C motif chemokine 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04062  Chemokine signaling pathway
fca04620  Toll-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100388 (CXCL9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101100388 (CXCL9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101100388 (CXCL9)
   04062 Chemokine signaling pathway
    101100388 (CXCL9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101100388 (CXCL9)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Chemokines
   101100388 (CXCL9)
SSDB
Motif
Pfam: IL8 Rtf2
Other DBs
NCBI-GeneID: 101100388
NCBI-ProteinID: XP_003985324
Ensembl: ENSFCAG00000008365
LinkDB
Position
B1:146196205..146202668
AA seq 126 aa
MKKSGIPLLLSIIFLTLLGGQGTLIMRNRRCFCINTSQGTIHLKSLKDLKQFAPSPSCEK
TEIIVTMKNGDQTCLNPDSADVQELIKEWEKQVSQKKKQKKGKKNQKSRKIFKVKKSQHP
HQKKTT
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaagaaaagtggtattcctcttttgttgagtatcatcttcctgactctgcttggcggt
caaggaaccctaataatgaggaatagacgctgtttctgcatcaacaccagccaagggaca
atccacctaaaatccttaaaggaccttaaacaatttgccccaagcccttcttgtgagaaa
actgaaatcattgtgacaatgaagaatggggatcaaacgtgtctaaacccagattcagca
gatgtgcaagaattgattaaagagtgggagaaacaggtgagccaaaagaaaaagcaaaaa
aaagggaaaaaaaatcaaaaaagcaggaaaatttttaaagttaaaaaatctcaacatcct
catcaaaagaagaccacatga

DBGET integrated database retrieval system