KEGG   Felis catus (domestic cat): 101100730
Entry
101100730         CDS       T02385                                 
Symbol
PRKCQ
Name
(RefSeq) protein kinase C theta type isoform X1
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04140  Autophagy - animal
fca04270  Vascular smooth muscle contraction
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04750  Inflammatory mediator regulation of TRP channels
fca04920  Adipocytokine signaling pathway
fca04931  Insulin resistance
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101100730 (PRKCQ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101100730 (PRKCQ)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101100730 (PRKCQ)
   04658 Th1 and Th2 cell differentiation
    101100730 (PRKCQ)
   04659 Th17 cell differentiation
    101100730 (PRKCQ)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101100730 (PRKCQ)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101100730 (PRKCQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101100730 (PRKCQ)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101100730 (PRKCQ)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101100730 (PRKCQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101100730 (PRKCQ)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101100730 (PRKCQ)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101100730 (PRKCQ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C ABC1 zf-RING_9 Kinase-like zf-RING_15 C1_2 zf-RING-like Pkinase_fungal APH Haspin_kinase
Other DBs
NCBI-GeneID: 101100730
NCBI-ProteinID: XP_003988131
Ensembl: ENSFCAG00000009472
UniProt: A0A337S2V7
LinkDB
Position
B4:complement(5937613..6124777)
AA seq 715 aa
MGPHGKGATMSPFLRIGLSNFDCGSCQPCQGEAVNPYCAVLVKEYVESENGQMYIQKKPT
MYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELSSLAERCRKNNGKAEIWLELKP
EGRMLMNARYFLEMSDTKDMSEFESEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPT
FCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMP
HRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEA
LAMIESTQQARCLRDSEHIFREGPVEIGLPCSIKGEARLPCVPASGKKEPQGISWESPLD
GMENIRHRPEPEPNIERPSLHMKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKAL
KKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQ
SCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENML
GDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSI
RMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPF
RPKVKSPYDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFINPGMERLIS
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgggacctcatggaaaaggagcaaccatgtcaccatttcttcgcattggtttgtccaac
ttcgactgtgggtcctgccagccatgtcagggagaggctgttaacccttactgcgctgtg
ctggtcaaagaatatgttgaatcagagaatgggcagatgtatatccagaaaaagcccact
atgtacccaccctgggacagcactttcgatgcccacatcaacaagggaagagtcatgcag
atcattgtgaagggcaagaacgtggacctaatatccgaaactactgtcgagctctcctct
ctggctgagcgatgcaggaagaacaatggcaaggcggagatatggttagagctaaaacct
gagggccgaatgctaatgaatgcaagatactttctggaaatgagtgacacaaaggatatg
agtgaattcgagtctgaaggcttctttgctttgcatcaccgccgaggagccatcaaacag
gccaaagtccaccacgtcaagtgccatgagtttaccgccacctttttcccccaacccaca
ttttgctctgtctgccatgagtttgtctggggtctgaacaaacaaggctaccagtgtcga
cagtgtaatgcggcaatccacaagaagtgtatcgataaagttatagctaagtgcacagga
tcagctatcaatagcagagaaaccatgttccacaaggagagattcaaaattgacatgcca
cacagattcaaagtctacaattacaaaagcccgaccttctgtgagcactgtgggaccctg
ctgtggggcctggcgaggcaaggactcaagtgcgacgcatgtggtatgaacgtacatcac
agatgccagacaaaggtggccaacctttgtggcataaatcagaaactgatggccgaagca
ctggcaatgattgagagcactcaacaggctcgctgcttaagagatagtgaacacatcttc
agagaaggtcccgttgaaattggtctcccgtgctccataaaaggtgaagcaaggctgccg
tgtgtaccagcatctgggaaaaaagagcctcagggaatctcttgggagtctcctttggac
gggatggagaacatacgccatcgtccagaacctgaaccgaacatagaaagaccatctcta
catatgaagctaaaaattgaggattttatcttgcacaaaatgttggggaaaggaagtttt
ggcaaggtcttcctagcagagttcaagaagaccaatcaattttttgcaataaaagcctta
aagaaagatgtggttttgatggacgatgatgttgagtgcacaatggtagagaagagagtt
ctctccttggcctgggagcatccgttcctaacgcacatgttctgtacattccagaccaag
gaaaacctcttttttgtcatggagtatctcaatggaggagacttaatgtaccacatccaa
agttgccacaagtttgatctttccagagccacgttctatgctgctgaaatcattctgggt
ctgcagttccttcattccaaaggaattgtgtacagagatctgaagcttgataatatcctg
ttagacaaagatggacacatcaaaatagcagactttggaatgtgcaaggagaacatgtta
ggagatgccaagacaaacactttctgcgggaccccggactacattgccccggagatcttg
ctgggccagaaatacaaccattctgttgactggtggtccttcggcgttctcctctatgag
atgctgattgggcagtcacctttccacgggcaagatgaagaggagcttttccactccatc
cgcatggacaatcccttttacccccgatggcttgagaaagaggcgaaggatcttttggtg
aagctcttcgtgagggaacctgaaaagagactaggagtgaggggagacatccgccagcat
cctttgttccgggagatcaactgggaagagcttgaaaggaaggagattgacccaccgttc
cggcctaaagtgaaatcaccgtatgactgcagcaatttcgacaaagagttcttaaatgag
aagccccggctatcatttgctgacagagccctcatcaacagtatggaccagaatatgttc
agaaacttttccttcatcaacccagggatggagaggttgatatcctga

DBGET integrated database retrieval system