KEGG   Felis catus (domestic cat): 101100741
Entry
101100741         CDS       T02385                                 
Symbol
IL22RA1
Name
(RefSeq) interleukin-22 receptor subunit alpha-1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04061  Viral protein interaction with cytokine and cytokine receptor
fca04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101100741 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100741 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101100741 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101100741 (IL22RA1)
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL10/28 receptor family
   101100741 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 101100741
NCBI-ProteinID: XP_019691954
Ensembl: ENSFCAG00000006118
LinkDB
Position
C1:complement(18001484..18020670)
AA seq 581 aa
MRTLLTILAVGSLAAHVAEGTSDLLQHVKFQSSNFENILTWDSRPESAPDTVYSVEYKKY
GEREWLAKEGCQRITRKSCNLTLETGNPMEHYYARVTAISAGGPSATKMTDRFSSLYHTT
IKPPNVTCIPKVRSIQMIVHPTTTPIHTGDGHRLTLEDIFPDLSYHLELQVNHTYQMHLG
GKQREYEFIGLTPDTEFLGAIRIFVPALVRESDPYTCRVKTLPDRTWTYSFSGAFLFSMG
FLVAGLCYLSYRYVTKPPPPPNSLDVQRVLTFQPLRFIQEHVLIPVFDLSSPSGLAQPVQ
YSQVKVSGPGEPPGAPPLHSLSEITYLGQPDISVLRPSGVPPHQALSPLSCAPQASPEVR
PPPYAPQVTPEAKPPSYMAQAISEVPPPSYTPQTTPDSWPSSYGMCVEGSGKDSPPVTLS
SPKHLRPKGQLQKEAPAGRYIPDGLSLQGVTSLDMGDPQEANSFHQHLGVHTDRVPDPSV
LHRGELGTPSYLKGQLPLLSSVQIEGHPVSLPLNTPSLPCSPTDQEPSPWGLLESLVCPK
DEEPVSETEAQSPAPQASDLKQPTELDSLFRDLALTVQWEA
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaggacgctactgaccatcctggccgtgggatccctggccgctcacgtggctgagggc
acctcggatcttcttcaacacgtgaaattccagtccagcaacttcgaaaacatcctgacg
tgggacagcaggccggagagcgccccagacacggtctacagtgttgagtataaaaagtat
ggagagagagagtggctggcaaaggagggctgccaacggatcacccggaaatcctgcaac
ctgaccttggagacgggcaaccccatggagcactactatgcccgcgtaactgctatcagc
gctggaggcccgtcggccaccaagatgaccgaccggttcagctccctgtatcacactacc
atcaaaccacccaatgtgacctgtatccccaaggtgagatccatccagatgattgtccat
cccaccaccacgcctatccacacaggggatggccaccggctaaccctggaggacatcttc
cctgacctgtcctaccacttagagctccaggtcaaccacacctaccagatgcaccttgga
ggcaagcagagggaatacgagttcattggcctgacccccgacacagagttccttggagcc
atcaggatttttgttccagccttggtcagagagagcgacccctacacgtgccgagtgaag
accttgccagatcggacgtggacatactccttctcgggcgccttcctgttctccatgggc
ttcctcgtcgcagggctctgctacctgagctacagatatgtcaccaagccacctccgcct
cccaactccctggacgtccagcgagtcctgaccttccagcctctgcggttcatccaggag
cacgtgctgatccctgtcttcgacctgagcagccccagcggtctggcccagcccgtccag
tactctcaagtcaaggtctccgggcccggggagcccccgggagccccaccgctgcacagc
ctgtctgagatcacctacctcgggcagccagacatttccgtcctccggccctctggagtg
ccgcctcaccaggcactctccccactgtcctgtgcgccccaggcttccccggaagttagg
cccccaccctatgcacctcaagtaacccccgaagctaaacctccatcatacatggcacag
gccatctctgaggtcccgcctccctcctacactcctcagaccactccagacagctggcct
tcttcctatgggatgtgtgtagaaggttctggcaaagactccccacctgtgacactctct
agtcccaaacacctcaggcctaaaggtcagctccagaaagaggcaccagctggaaggtat
atccccgatggcctttctctgcaaggggtgacctccttggatatgggggacccccaggaa
gcaaattccttccaccagcatctgggagttcacacggacagagtacctgaccccagtgtg
ctacacagaggggaactagggacaccgtcgtacctgaagggccagctccccctcctctcc
tctgtccagatcgagggccaccctgtatccctccctttgaacactccttccctcccctgt
tcccccacagaccaggaaccaagtccctggggcttgctggagtccctcgtgtgtcccaag
gacgaggagcctgtatctgagactgaggcccagagcccggcccctcaggcatcagacctg
aagcagcccacagaactggactctctcttcagagacctggccctgaccgtgcagtgggag
gcctga

DBGET integrated database retrieval system