KEGG   Felis catus (domestic cat): 101100862
Entry
101100862         CDS       T02385                                 
Symbol
LY96
Name
(RefSeq) lymphocyte antigen 96
  KO
K05400  lymphocyte antigen 96
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04620  Toll-like receptor signaling pathway
fca04936  Alcoholic liver disease
fca05132  Salmonella infection
fca05133  Pertussis
fca05145  Toxoplasmosis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101100862 (LY96)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101100862 (LY96)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101100862 (LY96)
   05133 Pertussis
    101100862 (LY96)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101100862 (LY96)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101100862 (LY96)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    101100862 (LY96)
SSDB
Motif
Pfam: E1_DerP2_DerF2
Other DBs
NCBI-GeneID: 101100862
NCBI-ProteinID: XP_003999946
Ensembl: ENSFCAG00000021962
UniProt: M3WZE4
LinkDB
Position
F2:25670497..25699771
AA seq 160 aa
MFPFILFSTLFSSTFTEPGELQWICNSSDSSVWYSHCDNMKVPISIAIKPCMSMKGSRGY
LHLSFIPRRDIKKLYFNLYLSINSMDLPVRKEVICRGSDDFYSFCRALKGETVNTTVGFS
FRGIRFSKGQYRCVAEAITGNTEEMLFCLNFTVIHDPNFN
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtttccatttatacttttttctactctgttttcttccacgttcactgaacctggggag
ctacagtggatctgcaactcttctgattccagtgtttggtattcccactgtgataacatg
aaagtccctatctcaatagctattaaaccctgtatgtcaatgaagggaagccggggatac
ttgcatctttccttcattccaagaagagatattaaaaagttatatttcaatctctattta
tccataaactccatggatttgccagtgcgcaaagaagttatttgccggggatctgacgat
ttttattctttttgcagagctctgaagggagagactgtgaatacaacagtaggcttctcc
ttcaggggaatacgattttctaagggacaatacagatgtgttgcagaagccatcactgga
aatactgaagaaatgctcttttgtctgaattttactgtcatacatgaccctaatttcaat
tag

DBGET integrated database retrieval system