KEGG   Felis catus (domestic cat): 101100930
Entry
101100930         CDS       T02385                                 
Symbol
ITGA2B
Name
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04015  Rap1 signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04611  Platelet activation
fca04613  Neutrophil extracellular trap formation
fca04640  Hematopoietic cell lineage
fca04810  Regulation of actin cytoskeleton
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05222  Small cell lung cancer
fca05410  Hypertrophic cardiomyopathy
fca05412  Arrhythmogenic right ventricular cardiomyopathy
fca05414  Dilated cardiomyopathy
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101100930 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    101100930 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101100930 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101100930 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101100930 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101100930 (ITGA2B)
   04611 Platelet activation
    101100930 (ITGA2B)
   04613 Neutrophil extracellular trap formation
    101100930 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100930 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101100930 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101100930 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101100930 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    101100930 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101100930 (ITGA2B)
   05414 Dilated cardiomyopathy
    101100930 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101100930 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101100930 (ITGA2B)
   04515 Cell adhesion molecules [BR:fca04515]
    101100930 (ITGA2B)
   04090 CD molecules [BR:fca04090]
    101100930 (ITGA2B)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101100930 (ITGA2B)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101100930 (ITGA2B)
Cell adhesion molecules [BR:fca04515]
 Integrins
  Integrin alpha subunits
   101100930 (ITGA2B)
CD molecules [BR:fca04090]
 Proteins
  101100930 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 101100930
NCBI-ProteinID: XP_003997036
Ensembl: ENSFCAG00000003056
LinkDB
Position
E1:complement(44410249..44424595)
AA seq 1037 aa
MARAVCPLHALWLLEWVQLLLGPDAVPPAWALNLDPVQLTFYTGPNGSHFGFSLDFYKDS
RGSVAIVVGAPRTRGRSQEETGGVFLCPWRTEGGQCTSLPFDLNDETRHVGFQTFQTFKA
GQGLGASVVSWNNNIVACAPWQHWNALEKTEEAEKTPVGGCFVAQLQTGYRAEYSPCRAN
IMSQGYVTNPFTEDKRYCEAGFSSAVTQAGELVLGAPGGYFFLGLLARAPIADIVSNYRP
GTLLWNVPAQRFSADYNNPVYFDGYRGYSVAVGEFDGDINTTEYVLGAPTWSWTLGAVEI
LNSYHQTLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVY
LFLQPRGHHPLGAPSVLLTGTQLYGRFGSAIAPLGDLDRDGYNDVAVAAPYGGPSGRGQV
LVFLGQSEGLSSRPSQILDSPFPTGSGFGFSLRGGTDIDDNGYPDLLVGAYGANQVAVYR
AQPVVMANVQLLVQDSLNPAVKNCVLPQTQTPVSCFNIQMCVGVTGHSIPRKLPLHAELQ
LDRQKPRQGRRVLLLNSQQAGTTLHLDLGGRHSPICHSTMAFLRDEADFRDKLSPIVLSF
NVSLQPEKDGIPPELVLHGDTHVQQQTRIILDCGEDDLCVPQLQLTANVMGAPLLIGADN
VLKLQMDAVNEGEGAYEAELVVRLPPGAHYMRAIGNIEGFERLICNQKKENETKVVLCEL
GNPMKRNARIGITMLVSVGDLEEAGERVSFWLQIRSKNSQNPNSEAVVLDVPVRAEAHME
LRGNSFPASLLMVAGEGNGENSSDSWGPKVEHTYELHNNGPSTVSGLHLSLSFPSQSQPS
DLLYILDIQPQGGLQCSPQPAPNPLKLNWGLPTPSPSPIYTGHHKRDRRQALLPGSNQPS
KLQDPVHLSCDSVPCTVVQCELQEMARGQRAMVTVLAFLWLPSLQQRPLDQFVLKSKAWF
NVSSLPYSVPALSLPSGEAVVETQLLRVLEERDIPIWWVLLGVLGGLLLLTVLVLAMWKV
GFFKRVRPPLEEDEEEE
NT seq 3114 nt   +upstreamnt  +downstreamnt
atggccagagctgtgtgtccacttcatgccctctggcttctggagtgggtgcagctgctc
ttgggacccgatgctgtccctccagcctgggccttgaacctggacccagtgcagctcacc
ttctacacaggccccaatggcagccactttgggttttcactggacttctacaaggacagc
cgtgggagcgtggccatcgtggtgggcgccccgaggacccggggccgcagccaggaggag
acgggcggcgtgttcctgtgcccctggaggaccgagggcggccagtgcacctcgctgccc
ttcgacctcaatgatgagacccgacacgtaggcttccaaaccttccaaactttcaaggcc
gggcaaggactgggggcgtcggtcgtcagctggaacaacaacattgtggcctgcgccccc
tggcagcactggaacgccctagaaaagacagaggaggctgagaagacgcccgtaggtggc
tgcttcgtggctcagctccaaaccggctaccgtgcggagtactcgccctgtcgggctaac
atcatgagccagggttacgtgacaaatccctttaccgaagacaagcgctactgcgaagcg
ggcttcagctccgcggtcactcaggctggagagctggtgcttggggcccctggcggctat
tttttcttaggtctcctggcgcgagctcctattgccgatatcgtctcgaattaccgccca
ggcaccctcttgtggaacgtgcccgcccagcgcttctccgcagactacaacaacccagtg
tacttcgacggctaccgggggtactcggtggccgtgggcgagttcgacggggatatcaac
actacagagtatgtcttaggcgcccccacctggagctggaccctgggagcggtggaaatt
ttgaactcgtaccaccagacgctgcaccggctgcacggagagcagatggcttcgtatttc
gggcactcggtggccgtcactgatgtcaacggggacgggaggcacgacctgctggtgggc
gcgccactgtacatggagagccgcgctgaccgcaaactggccgaggtggggcgtgtgtac
ttgttcctgcagcctcgcggtcaccacccactgggcgcccccagcgttctgctgacgggc
acacagctctacgggagattcggctccgccatcgcgcctctgggcgacctcgaccgggat
ggctacaacgatgttgcagtggccgccccctatgggggtcccagtggtcggggccaagtg
ctggtgttcctgggtcagagtgaggggcttagctcacgcccctcccagatcctggacagc
cccttccccacaggctctggcttcggcttctccctgcgaggtggcacagacatcgatgac
aacggatacccagacctactggtaggagcttatggggctaaccaggtggctgtgtacaga
gctcagccagtggtgatggccaatgtgcagctgctggtgcaagattcactgaatcctgct
gtgaagaactgtgtcctgccccagacccagacaccagtgagctgctttaacatccagatg
tgtgtaggagtcactgggcacagcattcctcggaagctgcccctacacgctgagctgcag
ctggaccggcagaagcctcgccagggccggcgggtgctactgctgaattctcaacaggcg
ggcaccaccctgcatctggacctgggcgggaggcacagccccatctgccactccaccatg
gccttcctccgggatgaggctgacttccgggacaagctgagccccatcgtgctcagcttc
aatgtgtccctgcagcccgagaaggacggaataccccccgagctcgtgcttcacggggac
acccatgtccagcagcagacccgcatcatcctggactgcggagaggatgatctgtgtgtg
ccccagctccagctcaccgccaacgtgatgggcgccccactcctcattggagccgacaat
gtgctgaagctacagatggatgcagtcaatgagggagagggggcctacgaggccgagctg
gttgtgcgcctgcccccaggtgcccactacatgagggccatcggcaacattgagggcttt
gagagactcatctgtaaccagaagaaagagaatgagaccaaggtggtgctgtgtgagctg
ggcaacccgatgaagagaaatgccaggataggaatcacgatgttggtgagcgtgggggac
ctggaagaggctggggagcgtgtgtccttctggctgcagatcagaagcaagaatagccag
aatccaaacagcgaggctgtggtgctggatgtaccagtccgggcagaggcccacatggaa
ctgcgagggaactcctttccagcctccttgctgatggtggcgggagaaggcaacggggag
aacagctcggacagctggggccccaaagttgagcacacctatgagctccataacaatggc
cccagcactgtaagtggcctccacctcagccttagctttcccagccagtctcagccctct
gacctgctctacatcttggatatacagcctcagggggggcttcaatgctccccacagccg
gctcctaaccccctcaagctgaactgggggctgcctacccccagcccttcccccatttac
acggggcatcacaagcgggaccgcagacaggccctcctgccagggtccaaccagccctcc
aagcttcaggatccagttcacctgagctgcgactcagtgccctgtacagtggtgcagtgt
gagctacaggagatggcacgagggcagcgggccatggtcacggtgctggccttcctgtgg
ctgcccagcctccagcagaggccactggatcagttcgtgctaaagtcaaaagcttggttc
aacgtctcctcccttccttactctgtgcccgccctcagcctgcccagtggagaagctgtg
gtcgagacgcagctgcttcgtgtcttggaagagagagacattccaatctggtgggtgctg
ttaggcgtattgggcggcctgctgttgctcacggtcctggtcctggccatgtggaaggtt
ggcttcttcaagcgtgttcggccaccactagaagaagatgaagaggaggagtga

DBGET integrated database retrieval system