KEGG   Felis catus (domestic cat): 101101236
Entry
101101236         CDS       T02385                                 
Symbol
DCN
Name
(RefSeq) decorin
  KO
K04660  decorin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04350  TGF-beta signaling pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101101236 (DCN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101101236 (DCN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:fca00535]
    101101236 (DCN)
Proteoglycans [BR:fca00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class I
    101101236 (DCN)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT LRR_6 DUF334
Other DBs
NCBI-GeneID: 101101236
NCBI-ProteinID: XP_003989159
Ensembl: ENSFCAG00000022438
UniProt: M3X0W2
LinkDB
Position
B4:complement(115249757..115291906)
AA seq 360 aa
MKATIIFLLLAQVSWAGPFQQRGLFDFMLEDEASGIGPEEHAPVDSDLEPLGPVCPFRCQ
CHLRVVQCSDLGLEKVPKELPPDTTLLDLQNNKITEIKDGDFKNLKNLHTLILVNNKISK
ISPGAFTPLLKLERLYLSKNHLKELPEKMPKTLQELRAHENEITKVRKAVFNGLNQMIVV
ELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLEGNKISKVDAA
SLKGLNNLAKLGLSFNSISAIDNGTLANTPHLRELHLDNNKLIRVPGGLAEHKYIQVVYL
HNNNISAVGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaaggcaactatcatctttctcctgcttgcacaagtttcctgggctgggccgttccaa
cagagaggcttatttgactttatgctagaagatgaggcttctgggataggcccagaagag
cacgctcctgttgattctgatttagagcctctggggccagtgtgtcctttccgctgtcag
tgccaccttcgagttgtgcagtgttctgatttgggtttggaaaaagtgccaaaagagctc
cctcctgacactacgctgctggacttgcaaaacaacaaaataaccgaaatcaaagatgga
gacttcaagaacctgaagaaccttcatacgttgatccttgtcaacaacaaaattagcaaa
atcagccctggagcatttacacctttgttgaaattggaacgactttatctgtccaagaat
catctgaaggaattgccagaaaaaatgcccaaaactcttcaggagctgcgtgctcacgag
aatgagatcaccaaagtgcgaaaagctgtgttcaatggcctgaaccagatgatcgtcgta
gaactgggcaccaacccgctgaagagctcgggaattgaaaatggagccttccagggaatg
aagaagctgtcctacatccgcattgccgacaccaatataaccaccatcccgcaaggtctt
cctccttcccttactgaattacatcttgaaggcaacaaaatctccaaagttgatgcagct
agcctgaaaggactgaataatttggctaagttgggactgagttttaacagcatctctgct
attgacaatggcactctggccaacactcctcatttgagggagcttcacttggacaacaat
aagcttatcagagtacctggtgggctggcggagcacaaatacatccaggttgtctacctt
cataacaacaatatctctgcagtcgggtctaacgacttctgcccacctggatacaacacc
aaaaaggcttcttattcaggtgtgagccttttcagcaacccagtccagtactgggagatc
caaccatccaccttccgatgtgtctatgtgcgttccgccatccagcttggaaattataaa
taa

DBGET integrated database retrieval system