KEGG   Felis catus (domestic cat): 101101237
Entry
101101237         CDS       T02385                                 
Symbol
IGF1
Name
(RefSeq) insulin-like growth factor I isoform X3
  KO
K05459  insulin-like growth factor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04114  Oocyte meiosis
fca04115  p53 signaling pathway
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04913  Ovarian steroidogenesis
fca04914  Progesterone-mediated oocyte maturation
fca04935  Growth hormone synthesis, secretion and action
fca04960  Aldosterone-regulated sodium reabsorption
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05205  Proteoglycans in cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05224  Breast cancer
fca05410  Hypertrophic cardiomyopathy
fca05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101101237 (IGF1)
   04014 Ras signaling pathway
    101101237 (IGF1)
   04015 Rap1 signaling pathway
    101101237 (IGF1)
   04066 HIF-1 signaling pathway
    101101237 (IGF1)
   04068 FoxO signaling pathway
    101101237 (IGF1)
   04151 PI3K-Akt signaling pathway
    101101237 (IGF1)
   04152 AMPK signaling pathway
    101101237 (IGF1)
   04150 mTOR signaling pathway
    101101237 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101101237 (IGF1)
   04115 p53 signaling pathway
    101101237 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101101237 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101101237 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    101101237 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    101101237 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    101101237 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101101237 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    101101237 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101101237 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    101101237 (IGF1)
   04213 Longevity regulating pathway - multiple species
    101101237 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101101237 (IGF1)
   05202 Transcriptional misregulation in cancer
    101101237 (IGF1)
   05205 Proteoglycans in cancer
    101101237 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    101101237 (IGF1)
   05218 Melanoma
    101101237 (IGF1)
   05215 Prostate cancer
    101101237 (IGF1)
   05224 Breast cancer
    101101237 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101101237 (IGF1)
   05414 Dilated cardiomyopathy
    101101237 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101101237 (IGF1)
   01522 Endocrine resistance
    101101237 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101101237 (IGF1)
Cytokines and growth factors [BR:fca04052]
 Growth factors
  Growth factors (RTK binding)
   101101237 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 101101237
NCBI-ProteinID: XP_003989226
Ensembl: ENSFCAG00000024009
UniProt: A0A2I2UWS2
LinkDB
Position
B4:complement(124977674..125055095)
AA seq 153 aa
MGKISSLPTQLFKCCFCDFLKVKMHIMSPSHLFYLGLCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKEVHLKNASRGSAGNKNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtaaagatgcacatcatgtccccctctcatctcttctatctgggcctgtgcttgctc
accttcaccagctctgccacagctggaccagagacgctctgtggggctgagttggtggac
gctcttcagttcgtgtgtggagacaggggtttttatttcaacaagcccacggggtatggc
tccagcagtcggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctgaggcggctagagatgtactgtgcacccctcaagcctgccaagtctgcccgctca
gtccgtgctcagcgccacactgacatgcccaaggctcagaaggaagtacatttgaagaac
gcaagtagagggagtgcgggaaacaagaactacagaatgtag

DBGET integrated database retrieval system