KEGG   Felis catus (domestic cat): 101101498
Entry
101101498         CDS       T02385                                 
Symbol
CBLB
Name
(RefSeq) E3 ubiquitin-protein ligase CBL-B isoform X1
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04012  ErbB signaling pathway
fca04120  Ubiquitin mediated proteolysis
fca04144  Endocytosis
fca04625  C-type lectin receptor signaling pathway
fca04660  T cell receptor signaling pathway
fca04910  Insulin signaling pathway
fca05162  Measles
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101101498 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101101498 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101101498 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101101498 (CBLB)
   04660 T cell receptor signaling pathway
    101101498 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101101498 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    101101498 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101101498 (CBLB)
   04121 Ubiquitin system [BR:fca04121]
    101101498 (CBLB)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101101498 (CBLB)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101101498 (CBLB)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    101101498 (CBLB)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 zf-rbx1 UBA zf-RING_4
Other DBs
NCBI-GeneID: 101101498
NCBI-ProteinID: XP_006936081
Ensembl: ENSFCAG00000004555
UniProt: M3W2E6
LinkDB
Position
C2:complement(52955259..53179953)
AA seq 984 aa
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGVPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPHPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHFHHVESVPSRDQPMPLEAWCPRDVFG
SNQSVVGCRLLGDGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGH
LGSEEYDVPPRLSPPPPAAALLPSIKCTGPLANSLSEKTRDPVEEDDDEYKVPSSHPVSL
NSQPSHCHNVKPPLRSCDNGHCILNGTHGTSSEMKKPNIPELGIYLKGDVFDSASDPVPL
PPARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKP
PGSNSRPSSGQDLFLLPSDPFLDPASGQVPLPPARRLPGENVKANRASQDYDPLPSSSDG
SQAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQN
NVEVARSILREFAFPPPVSPRLNL
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggcaaattctatgaatggcagaaaccctggtggtcgaggaggaaacccccgaaaagga
agaattttgggaattattgatgctattcaagatgcagttggacctcccaagcaagcagca
gcagatcgcaggactgtggagaaaacttggaaactcatggacaaagtggtcagactgtgc
caaaatcccaaacttcagttgaaaaatagcccaccatacatacttgatattttacctgat
acatatcaacatttgcgacttatattgagtaaatatgatgacaaccaaaaacttgcccaa
ctcagtgagaatgagtattttaaaatctacattgacagtttaatgaaaaagtcaaaacgg
gcaataagactctttaaagaaggcaaggagaggatgtacgaagagcagtcacaggacaga
cgaaatctcaccaaactgtcccttatcttcagtcatatgctggcagaaattaaagcaatc
tttcctaatgggcaattccagggagataactttcgtatcacgaaagcagacgctgctgag
ttctggagaaagttttttggagacaagactattgtgccatggaaagtattcagacagtgc
cttcatgaggttcatcaaattagctccggcctggaagcaatggctctgaaatcaacaatt
gatttaacttgtaatgattacatttcagtttttgaatttgatatttttaccagactcttt
cagccttggggctctattttacggaattggaatttcttagctgtaacacatccaggttac
atggcatttctcacatatgatgaagttaaagcacgactacagaaatacagcaccaaaccc
ggaagctacattttccggttaagctgcactagattgggacagtgggccattggctatgtg
acaggggatggcaatatcttacagaccataccgcataacaagcccttatttcaagccctg
attgacggcagcagggaaggattctatctttatcctgatgggaggagctataatcctgat
ttaactggattgtgtgaacctacaccccatgatcatataaaagttacccaggaacaatat
gaattatattgtgaaatgggctccacttttcagctttgtaaaatttgtgctgagaacgac
aaagatgtcaagattgagccttgtgggcatttgatgtgcacctcttgccttacagcatgg
caggagtcagatggccagggctgccccttctgtcgctgtgaaataaaaggaacagagccc
atcatcgtcgacccctttgatccaagggacgaaggttccaggtgctgtagcatcattgac
ccctttggagtgccgatgctggacctggatgatgatgatgaccgagaggagtccttgatg
atgaatcggttggcaaatgttcgaaagtgcactgacaggcagaattcaccagttacatca
ccaggatcctctccccttgcacagagaagaaagccgcatccagatcctctccagatccca
catctaagcctgccaccagtgcctcctcgcctggacttaattcagaaaggcatagttcgg
tctccctgtggcagccccactggttcaccaaagtcttctccttgcatggtgagaaagcaa
gataaaccactccccgcacctcctcctcccttacgagatcctcctccgcctccacctgag
agacctcccccaatcccacctgacaatagactgagtcgtcacttccatcacgtggaaagt
gtgccttctagagaccagccaatgcctcttgaagcctggtgccctcgggatgtgtttggg
agtaatcagtcggtggtgggatgtcgactcttaggggatggctctccaaagcctggaatc
acagcaagttcaaatgtgaatggaagacacagtagagtgggctctgaccccgtgcttatg
cggaaacacagacgccatgatttgcctttagaaggagccaaggtcttttccaatggtcac
ctgggaagtgaagaatatgatgttcctccccggctttctcctcctcctccagctgctgcc
cttctccctagcatcaagtgtactggcccgttagcaaattccctttcagagaaaaccaga
gacccagtagaggaagatgacgatgaatacaaggttccttcatcccatcctgtttccctg
aattcacaaccatctcattgccataacgtaaaacctcctcttaggtcctgtgataatggt
cattgtatattgaatggaacacatggtacatcttcagagatgaagaaaccaaacatccct
gaattaggcatatatttaaagggagatgtttttgattcagcctctgatccagtgccatta
ccacctgccaggcctccaactcgggacaatccaaagcatggttcttcactcaacaggacg
ccctctgattatgatcttctcatccctccattaggtgaagatgcttttgatgccctcccc
ccatccctgccacctcccccaccgcctgcaaggcacagcctcatcgaacactcaaaacct
cctggctccaatagccgaccatcctcaggacaggaccttttccttcttccttcagatccc
tttcttgatccagcaagtggccaagttcctttgcctcctgctaggagattaccaggcgaa
aatgtcaaagccaacagagcatcacaggactatgatccgcttccttcatcttcagatggt
tcacaagcaccagccagacctcctaaaccacgaccccgcaggactgcaccagaaatccac
cacagaaaaccccatgggcccgaggcagcattggaaaatgttgatgcgaaaattgcaaaa
ctcatgggagagggttatgcctttgaagaagtgaagagagccttagagatagctcagaat
aacgtcgaagtggcgcgtagcatcctccgagaatttgccttcccgcctccagtctctcca
cgtctaaatctatag

DBGET integrated database retrieval system