KEGG   Felis catus (domestic cat): 101101514
Entry
101101514         CDS       T02385                                 
Symbol
TSC1
Name
(RefSeq) hamartin isoform X1
  KO
K07206  tuberous sclerosis 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04218  Cellular senescence
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05168  Herpes simplex virus 1 infection
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    101101514 (TSC1)
   04151 PI3K-Akt signaling pathway
    101101514 (TSC1)
   04152 AMPK signaling pathway
    101101514 (TSC1)
   04150 mTOR signaling pathway
    101101514 (TSC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101101514 (TSC1)
  09143 Cell growth and death
   04218 Cellular senescence
    101101514 (TSC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101101514 (TSC1)
  09149 Aging
   04211 Longevity regulating pathway
    101101514 (TSC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101101514 (TSC1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101101514 (TSC1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101101514 (TSC1)
   05163 Human cytomegalovirus infection
    101101514 (TSC1)
   05165 Human papillomavirus infection
    101101514 (TSC1)
SSDB
Motif
Pfam: Hamartin
Other DBs
NCBI-GeneID: 101101514
NCBI-ProteinID: XP_019672267
Ensembl: ENSFCAG00000007112
LinkDB
Position
D4:complement(92640091..92690273)
AA seq 1161 aa
MAQQANIGELVSMLDSPVLSVRDDVTAVFKENLNADRGPMLVNTLVDYYLETSSQPVLHI
LTTLQEPHDKHLLDKMNDCVGRAASRLPALSLLGHVIRLQPPWKHKLSQAPLLPSLLKCL
KVDTDVIVLTTGVLVLITMLPMIPQSGKQHLHDFFDIFGRLSSWCLKKPGHVTEIYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENLDTFEEVVRPMMEHVRIHPELVTGSKDH
ELDPRRWKRLETHDVVIECAKISLDPTEASYEDGDSVSPQVSAHFPHRAADVAASPYVDT
QNSCGSATSTPYSSSRLTLLNTPGQPPRTLSPPSTRLLTEPPQATLWSPSMVCGMTTPPT
SPGNVPPDLSHPYSKVFGPTGGKGTPLGTPATSPPPAPLCHPDDYVHPSVLQATATPPRK
EERTDSARPCLHRQHHLPNDRGLEELSGSKGSVTLSDLPGFLGDLASEEDSVEKDKEEAA
ISKELSEITTADAELLVPRGGFDSPFYRDSLPGCPRKTHSAASVAHGTSVNPEPLNSSLD
KLGPDAPKQAFTPIDLPCGGTSESPAGNRERQASLETNILTPSPCKIPPQRGVGLGSGQP
PPYEHLFEVALPKTAHHFVGKKTKELLKKAKGNVEEDRAPSTSPVEILDRLIQQGADAHS
KELNRLSLPSKSVDWTHFGGSPPSDEIRTLRNQLLLLHNQLLYERFKRQQHALRNRRLLR
RVTRAAALEEHNAAMKDQLKLQEKDIQIWKVSLQKEQARNSQLQEQRDTMVTQLHSQIRQ
LQHDREEFYNQSQELQTKLEDCRNMIAELRLELKKANSKVCHTELLLSQVSQKLSNSESV
QQQMEFLNRQLLVLGEVNELYLEQLQNKHSDTTKEVEMMKAAYRKELEKNRSHVLQQNQR
LDTSQKRILELESHLAKKDHLLLEQKKYLEDVKLQARGQLQAAESRYEAQKRITQVFELE
ILDLYGRLEKDSLLKKLEEEKAEAAEAAEERLACCKDGCSDSVTGHNEEAPGHNGETKPP
RPAGVRGGGGGRGGGSGELSTPEKPPSQRAGPFGSRWETTTGEPATSIPTTVGSLPSSKS
FLGRKARELFRNKSESQCDEDSVTISSLSETLKTELGKDPGAEGKAPPSLDGPHPSPPTP
DSVGQLHIMDYNETHHEHSEG
NT seq 3486 nt   +upstreamnt  +downstreamnt
atggcccagcaagccaacatcggggagctcgtctccatgctggactcccccgtgctgagc
gtgcgtgacgatgtaacagccgtctttaaagagaacctcaatgctgaccgtggtccgatg
ctcgtaaacaccttggtggattattacctggaaaccagttctcagccggtgttgcacatc
ctgactaccctgcaagagccgcacgataagcacctcctggacaaaatgaacgactgtgtg
ggcagagccgcctcgcggttgcccgccctgtcgttgctgggccacgtcatcaggctgcag
ccgccctggaagcacaagctgtctcaagcacctctcttgccttctttgctcaaatgtctc
aaggtggacaccgatgtcattgtccttacaacaggtgtcttagtgttgataaccatgcta
ccaatgattccacagtcggggaaacagcaccttcatgatttctttgatatttttggccgt
ctttcgtcgtggtgcctgaagaaaccaggccacgtgacggaaatctatcttgtccatctc
cacgccagcgtctacgctctttttcatcgcctctatggaatgtacccttgcaactttgtc
tcctttctacgctctcactacagtatgaaggagaacttggacacttttgaagaggtggtc
aggccgatgatggagcatgtgcgaattcacccggaattagtgactggatccaaggaccac
gaactggaccctcgaaggtggaagagattagaaacgcacgatgttgtgatagagtgtgcc
aaaatctctctggaccccacagaagcctcgtatgaagacggcgactctgtgtccccccag
gtgtcagcacactttcctcatcgtgcggccgatgtggccgccagcccttacgtcgacacg
cagaatagctgtgggagtgctacctcgaccccttattccagctctcggctgacattgtta
aatacgcccgggcagccacctcggactctgagtcccccatcaacacggctgttgactgag
ccgccacaagctactctctggagcccatctatggtttgtggtatgaccactcctccaact
tctcctggaaacgtcccacctgacctgtcacacccttacagtaaagtctttggtccaact
ggtggaaaagggactcctctgggaaccccagcaacttctcctcctccagccccactctgc
cacccggacgactacgttcacccatccgtcctgcaggccacggccacaccccccaggaag
gaagagagaacagattcagcaaggccctgtctacacagacaacaccatcttccgaatgac
agaggattagaagagctgtctggcagcaaaggttctgtcactctcagtgaccttccaggg
tttttaggggacctggcctcggaagaagatagtgttgaaaaagataaagaagaagcggca
atatctaaagagctctccgagatcaccacagctgacgccgagctcctggttcctcgagga
ggctttgactctcccttctaccgggacagtctcccgggctgccctcggaagacccattcg
gccgcctccgtcgctcacggcaccagtgtgaaccctgagcctttaaactcctccctggac
aagcttgggcctgacgcaccaaagcaagcctttactcccatagatctgccctgtggaggc
accagcgagagccctgccgggaacagggagcgccaggcttcgctggagaccaacatcctc
actcccagcccttgtaaaatcccgcctcagaggggcgtgggccttggaagtgggcagcct
cccccttacgagcatctttttgaggtggcgttgccaaagaccgcccatcacttcgtcggc
aagaagaccaaggaactgttaaagaaagcgaaaggaaacgtggaggaagaccgtgcgccc
tctacctccccagtggaaatactggatagactgatacagcagggagcggacgcacacagc
aaggagctgaacaggttgtctttacccagcaagtctgtcgactggacccactttggaggc
tctcctccctcagatgagatccgcaccctccgtaaccagttgcttttactgcacaaccag
ctgctctatgagcgttttaagaggcagcagcacgctctccggaacaggcgactcctccgt
cgggtgaccagggcggcggctctggaggagcacaatgccgccatgaaagaccagctgaag
ttacaagagaaggacatccagatatggaaggtcagtctgcagaaggaacaagccagaaac
agtcagctgcaggagcagcgagacacgatggtgacccagctccacagccagatcagacag
ctgcagcacgaccgagaggagttctacaaccagagccaggagctgcagacaaagctggag
gactgcaggaacatgatcgcagagctgcgtctggagttgaagaaggccaacagtaaggtg
tgccataccgagctgctgctcagtcaggtctcccagaagctctcgaacagcgagtcggtc
cagcagcagatggagttcttgaacaggcagctgctggtccttggggaggtcaacgagctg
tatctggagcagctgcagaacaagcactcggacaccacaaaggaagtggaaatgatgaaa
gctgcatatcggaaagaactagaaaaaaacagaagccacgtcctccagcagaatcagagg
ctcgacacctctcagaaacggattttggaactggaatctcacctggccaagaaagaccac
cttcttttggaacagaagaaatatttagaggatgtcaaactccaggccagaggacagctg
caggcggcagagagcaggtatgaggctcagaagaggatcacccaggtgtttgagctggag
atcttagatttatacggcaggttggagaaggacagcctcctgaagaaacttgaagaagaa
aaggcagaagcagcagaagcggcagaagaaaggcttgcctgttgtaaggacggctgctcg
gattctgtaacagggcacaacgaagaggcacctggccacaacggcgagaccaagcccccc
aggcccgccggcgtgcggggcggcggtggaggcagagggggcggcagcggcgagctctcg
accccggagaagccccccagccagagggcgggcccgttcggcagtcggtgggagacgacc
acgggagagcccgccaccagcatcccgaccaccgtcggctcccttcccagttcgaaaagc
ttcctgggcaggaaggcgcgagagttatttcgtaataagagcgagagccagtgtgacgag
gacagtgtgaccatcagtagcctttctgaaacgctaaagacagaactgggcaaagacccg
ggtgcggaaggcaaggcccccccgagcctagacggcccgcacccgtcccccccgaccccg
gacagtgttggacagctgcacatcatggactacaacgagactcatcatgaacacagcgaa
ggatga

DBGET integrated database retrieval system