KEGG   Felis catus (domestic cat): 101101575
Entry
101101575         CDS       T02385                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101101575 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101101575 (TNFRSF8)
   04090 CD molecules [BR:fca04090]
    101101575 (TNFRSF8)
Cytokine receptors [BR:fca04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101101575 (TNFRSF8)
CD molecules [BR:fca04090]
 Proteins
  101101575 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6 CoV_E
Other DBs
NCBI-GeneID: 101101575
NCBI-ProteinID: XP_023113904
Ensembl: ENSFCAG00000001453
LinkDB
Position
C1:8861829..8928610
AA seq 595 aa
MRPLRAVLGLLLLGVLGAFPQDRVPRDVYAGDPGHHHDKTAGLPCPQGSPDCRKQCEPDY
YLNRDGRCTACVSCARDDLVEKMPCSGNSSRVCECRTGTFCATSATNSCARCIPHTVCPK
GMIVKVQGTAQMDTVCEQPSPVTSPDLGTGPEDCQAPTSDTSAQAGPLVTSSVSSGARTT
LLGGGTAITPEDDSKKTGAPGSPSSVRKPSPDPGLTLQLPCPQGSPDCRKQCEPDYYLDR
DGHCTACVSCARDDLVEKTPCTWNSSRVCECRPGMFCVTPVTNSCAHCVTRPVCPPGMAT
KPQGTAERDATHEPPPPLEAHPECSTNPEDSKAPTSATASPVSAADPQGSKEHGGGNTHT
WGDTFTSTSSPISFSSTGKPILVSGPVLFWMVMILVVVLVSISFLLCHWRACRKWIRQKL
HLCYPAQTFRPTLEPVDSRPRRNLTQLRSCISVAKSGTEELGLMGPPAVETCPNGEACLQ
SMRLLDASPAGSPPSPRDLPEPRVTSEHTNNRIEKIYIMKADTVIVGTVRTEVPEGRGLA
GPTGPELEEDLEGDHAYPHFPEQETEPPLDSCGDVMFSVEEEGKEAPLPMTVSEK
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcgccccctccgcgctgtgctgggactgctgctcctgggggtgctgggagccttcccg
caggatcgagttccgagggacgtctatgctggagaccctggccaccatcacgacaaaact
gccgggctgccgtgcccccaggggtcacctgactgcaggaagcagtgtgagcccgactac
tacctgaacagggacggccgctgcacggcctgtgtgagctgtgctcgagacgatcttgtg
gagaagatgccgtgctcagggaactcctcccgcgtctgtgagtgccgcactggcacgttc
tgtgccacatcagccaccaactcctgtgcccgctgcatcccccacaccgtctgcccgaaa
gggatgattgtcaaggtccagggcacagcacagatggatactgtgtgtgagcagccttcc
ccggtgaccagccctgacctcggcacgggcccagaagactgccaggcgcccaccagcgac
accagcgcccaggccgggcccctggtgacctcctcagtgagctccggtgccaggaccacg
ctccttggagggggcactgccatcacccccgaagatgattccaaaaagacgggggccccc
ggctctccgtcctctgtgaggaagcccagtccagatccagggctgaccctgcagctgccg
tgcccccaggggtcacctgactgtaggaagcagtgtgagcccgactactacctggacagg
gacggccactgcacggcctgtgtgagctgtgctcgagatgacctggtggagaagacaccc
tgtacctggaactcctctcgtgtctgcgaatgtcgacctggcatgttctgtgtcacacca
gtcaccaactcctgtgcccactgtgtcacccgccccgtctgcccaccaggcatggccacc
aaaccccagggtacagctgagagggatgccacccatgagccgccgcctcccctagaagcc
caccccgagtgcagcaccaacccagaggacagcaaggcgcccaccagcgccacggcctct
ccggtctccgcagcagacccccaaggcagtaaggagcatggagggggcaacacccacacc
tggggagacaccttcacgtcaacgagctcccctatctctttctcctccacgggaaagccc
attctggtttcaggacctgtgctcttctggatggtcatgatcctggtggtggtcttggtc
tccatctccttcctcctgtgccactggagggcctgcaggaagtggattcggcagaagctc
cacctgtgctaccctgcccagaccttccggcccacgctggagcctgtggattccaggccc
aggaggaacctgacccagttgaggagttgcatatcggtggccaagtcgggcacagaggag
ctgggattaatgggccccccggccgtggagacctgccccaacggggaagcctgcctgcag
agcatgcggctgctggatgccagcccggccgggagccccccatcccccagggaccttccc
gagccccgggtgacctcagagcataccaacaacaggatcgagaaaatctacatcatgaag
gctgacacagtgattgtggggaccgtgaggaccgaggtgcctgagggccggggcctggcg
gggccgacggggcctgaattggaggaggatctggaaggggaccacgcgtacccccacttc
ccggagcaggagacagagccgcctctggacagctgcggggacgtcatgttctcagtagaa
gaggaaggaaaggaggcccccttgcccatgactgtctctgagaaatga

DBGET integrated database retrieval system