KEGG   Felis catus (domestic cat): 101101618
Entry
101101618         CDS       T02385                                 
Symbol
SLC6A3
Name
(RefSeq) sodium-dependent dopamine transporter
  KO
K05036  solute carrier family 6 (neurotransmitter transporter, dopamine) member 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04721  Synaptic vesicle cycle
fca04728  Dopaminergic synapse
fca05012  Parkinson disease
fca05022  Pathways of neurodegeneration - multiple diseases
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    101101618 (SLC6A3)
   04721 Synaptic vesicle cycle
    101101618 (SLC6A3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101101618 (SLC6A3)
   05022 Pathways of neurodegeneration - multiple diseases
    101101618 (SLC6A3)
  09165 Substance dependence
   05030 Cocaine addiction
    101101618 (SLC6A3)
   05031 Amphetamine addiction
    101101618 (SLC6A3)
   05034 Alcoholism
    101101618 (SLC6A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101101618 (SLC6A3)
Transporters [BR:fca02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   101101618 (SLC6A3)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 101101618
NCBI-ProteinID: XP_023102813
Ensembl: ENSFCAG00000002581
LinkDB
Position
A1:241225144..241271020
AA seq 921 aa
MAEWGGHRPPRLSRPLRRNRLPRRTVRAFGPSGCARLQKAPGDRQVPGGPEALARGPRGQ
GSAPGGSSRCRGQPRGAGDADGTAPAGPGTPRRRPNLAPREHRLGDARGAGRGKGGCWGR
SRCRRTVGDQGPRSRGTGRVGAPSSARESQCCARRARRPAPSPPAAPPGQTRGHRDRFLR
AAAVLGPRNPEPGRVPAPTRPRPRDARGPRRRGAARAAGSGGGGGDGGAPGSGPPPTRGG
EGAGRGGAGLRHHKSPEAAAARRCGTRAGAGAFAGARRRDPSAATSPGRAGRRRTHRVRV
PRLRTSESQRPEVPMSSGVAPAKEPNATGPKAVELVLVKEQNGVQFTSSTLINPTQTPVE
TQERETWSKKVDFLLSVVGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMAIAGVPLFYM
ELALGQFTREGAAGVWKICPLLKGVGFTVILISLYVGFFYNVIIAWALHYFFSSFAAELP
WVHCNNTWNSPDCVDARSTGPGSGPNRTLHTTPATEYFERGVLHLHESRGIDDLGPPRWQ
LTSCLVLVIILLYFSLWKGVKTSGKVVWITATMPYAVLFALLLRGLTLPGAVDGIRAYLS
VDFHRLCESSVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAVITTSVNSLTSFS
SGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEALATLPLSSAWAVVFFIMLLTLG
IDSAMGGMESVITGLTDEFQLLHRHRELFTLSIVLATFFLSLFCVTNGGIYVFTLLDHFA
AGTSILFGVLIEAIGVAWFYGVRQFSDDIQQMTGRRPSLYWRLCWKFVSPCFLLFVVVVS
VVTFRPPHYGAYAFPKWANALGWAIASSSMCMVPVYAAYKLCSLPGSLREKLAYAITPEQ
ERELVDSGEVRQFRLRHWLLV
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggcggagtggggtgggcaccggccgccgcggctctccaggcccctccggagaaaccgg
ctcccgaggcgcaccgttcgggcctttggtcccagtggctgcgcgcggctccagaaggcc
ccgggcgaccgccaggtacctggcggcccagaggccctggcacggggtcccagggggcaa
gggagtgccccgggcggctctagcaggtgcaggggtcagccccgcggggccggggacgcc
gacgggacagcacccgccggacccgggaccccgcgccgccggccgaacctcgctccgcgc
gagcacaggctgggagacgcccggggcgccggccgcgggaagggaggctgctgggggagg
agtcggtgccgccggacggttggggaccagggtccgcgcagcagagggacggggcgagtc
ggggcgcccagctctgcccgcgagtcccagtgctgcgcccggcgcgcccgccgccccgct
ccctccccgcccgccgctcccccggggcagacgcggggacaccgggaccggttcctccgg
gcagccgccgtcttgggcccgcgaaacccggagcccggacgtgtccccgctcccacgcgt
ccgaggccccgggatgcgcgaggtccccggcggagaggagctgcgcgggcggccgggtcc
gggggcgggggcggggacgggggcgcgcccgggtctggtcctccgcccacccggggcggg
gagggggcggggcggggcggggcgggcctgcgacaccataagagccccgaggccgcggcc
gcccggcgctgcgggacccgagccggcgctggagctttcgcgggcgcccggcggcgggac
cccagcgcggcgacgagtccggggcgggcaggccggaggaggacgcaccgagtccgagtc
cccaggctgcgcaccagtgagagccagcgcccggaggtgccgatgtcttccggcgtggcc
ccagctaaggagcccaacgctacgggccccaaggccgtggaacttgtcctggtcaaggag
cagaatggggtgcagttcacaagctccaccctcatcaaccccacgcagacgcccgtggag
acccaagaacgagagacctggagcaagaaggtcgacttcctcctgtcggtggtcggcttt
gccgtggacctggccaacgtctggcggttcccctacctgtgctacaaaaacggcggcggc
gccttcctggtcccctacctgctcttcatggccattgctggggtgccgctcttctacatg
gagctggccctggggcagttcaccagggaaggggccgctggcgtctggaagatctgcccc
ctgctgaaaggcgtgggcttcacggtcatcctcatctccctgtacgtgggcttcttctac
aacgtcatcatcgcctgggcgctgcactacttcttctcctccttcgccgcggagctgccg
tgggtccactgcaacaacacgtggaacagccccgactgcgtggacgcgcgctccaccggc
cccggctcgggccccaaccgcaccctccacaccacgcccgccaccgagtacttcgagcga
ggcgtgctgcaccttcacgagagccgtggcatcgacgacttgggcccccctcggtggcag
ctcacatcctgcctggtgctggtcatcatcctcctctactttagcttgtggaagggagtg
aagacttctgggaaggttgtgtggatcacggccaccatgccgtacgccgtcctctttgcc
ctgcttcttcgaggactcactctccctggggccgtcgacggcatccgagcgtacctgagc
gtagacttccaccgactctgcgagtcttctgtctggatagatgccgccacccaggtgtgc
ttctcgctgggcgtcggcttcggggtgctgatcgccttctccagctacaataagttcacc
aacaactgctacagagacgcggtcatcaccacttcggtcaattccctgacgagcttctcc
tccggcttcgtggtcttctccttcctggggtacatggcccagaagcacagcgtgcccatc
ggagacgtggccaaggacgggcccgggctgatcttcatcatctaccccgaggcgctggcc
acgctcccgctgtcctcggcctgggccgtggttttcttcatcatgctgctcaccctgggg
atcgacagcgccatgggcggcatggagtcggtgatcaccgggctcaccgacgagttccag
ctgctgcaccggcaccgggagctcttcaccctctccatcgtcctggcgaccttcttcctc
tccctcttctgcgtcaccaacgggggcatctacgtgttcacgctgctggaccacttcgcg
gccggcacgtccatcctctttggagtgctcatcgaggccatcggggtggcctggttctac
ggcgtgcggcagttcagcgacgacatccagcagatgaccgggcggcggcccagcctgtac
tggaggctgtgctggaagttcgtgagcccctgcttcctcctgtttgtggtcgtggtgagt
gtcgtgaccttcaggcccccgcactacggagcctacgccttccccaagtgggccaatgcc
ctgggctgggccatcgcctcgtcctccatgtgtatggtgcccgtctacgcggcctacaag
ctctgcagtctgcccggctccctgcgggagaaactggcatacgccatcacacccgagcag
gagcgcgagctggtggacagcggggaggtgcgccagttcaggctgcgccactggctcctg
gtgtag

DBGET integrated database retrieval system